LXL04_030979 | RubberDandelionOmics

Gene overview

LXL04_030979

Reference: OH-1004 Chr: Chr06 Coordinates: 126178462-126180615 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · LXL04_030979|LXL04_030979|OH1004|cDNA

ATGCTTACGATTCTTCAATCGACTACAATCACTCTAATGTTAACCATTCATATTTTGATGTTTGATGTTTCAGCTGCAAATTTGGTTTCTACTCATAGTGCACACGCATTGAATATGGACGCAATCATGGAAAGAACAGCTTCTTCTGTATACACCTTAGCTGATGGAGGCCTTGGGGATTGGTTTGGAAACTTAATGTATTCAGCTGGACAACAAGCAAATGAAGCTGTTCAGATCCAGCTAGGAGCTCTAAGTATAAC...

CDS

Download CDS FASTA

939 bp · LXL04_030979|LXL04_030979|OH1004|CDS

ATGCTTACGATTCTTCAATCGACTACAATCACTCTAATGTTAACCATTCATATTTTGATGTTTGATGTTTCAGCTGCAAATTTGGTTTCTACTCATAGTGCACACGCATTGAATATGGACGCAATCATGGAAAGAACAGCTTCTTCTGTATACACCTTAGCTGATGGAGGCCTTGGGGATTGGTTTGGAAACTTAATGTATTCAGCTGGACAACAAGCAAATGAAGCTGTTCAGATCCAGCTAGGAGCTCTAAGTATAAC...

Protein

Download Protein FASTA

312 aa · LXL04_030979|LXL04_030979|OH1004|PROTEIN

MLTILQSTTITLMLTIHILMFDVSAANLVSTHSAHALNMDAIMERTASSVYTLADGGLGDWFGNLMYSAGQQANEAVQIQLGALSITSLAVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEIVGDSLAFAFGLATTLALLGVAASFAGKAYGQVGQGLPLAASGLAVIMGLNLLEVIELQMPSFLDNFDPRAAAANFPSSVQAYLAGLTFALAASPCSTPVLATLLGYVAASKDPIIGGSLLLTYTTGYVAPLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030979`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030979

Location Chr06:126178462-126180615 (+)

Description Similar to CCDA2: Cytochrome c-type biogenesis ccda-like chloroplastic protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54290`	Required for the transfer of reducing equivalents from stroma to thylakoid lumen.	A homolog of prokaryotic thiol disulfide transporter CcdA is required for the assembly of the cytochrome b6f complex in Arabidopsis chloroplasts.2004 · DOI: 10.1074/jbc.m404285200 CcdA is a thylakoid membrane protein required for the transfer of reducing equivalents from stroma to thylakoid lumen in the higher plant chloroplast.2010 · DOI: 10.1089/ars.2010.3138

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0137300`	Probably involved in the transfer of reducing equivalents from stroma to thylakoid lumen and required for the biogenesis of the plastid cytochrome b6f complex.	No verified direct reference in this release
`Os11g0140800`	Probably involved in the transfer of reducing equivalents from stroma to thylakoid lumen and required for the biogenesis of the plastid cytochrome b6f complex.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030979 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010190 cytochrome b6f complex assembly Biological Process

GO:0017004 cytochrome complex assembly Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0055035 plastid thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT5G54290

dosa:Os11g0140800

dosa:Os12g0137300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · LXL04_030979 · OH-1004

Mitochondrion0.023

Rank 2 · LXL04_030979 · OH-1004

Cytoplasm0.016

Rank 3 · LXL04_030979 · OH-1004

Peroxisome0.014

Rank 4 · LXL04_030979 · OH-1004

Nucleus0.013

Rank 5 · LXL04_030979 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02683.23DsbD_TM87-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030979	`PF02683.23`	DsbD_TM	87	269	2.9e-23	83.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M5P3`	Arabidopsis thaliana	Cytochrome c-type biogenesis ccda-like chloroplastic protein	75.081%	Swiss-Prot	strong database homology
`Q2QY07`	Oryza sativa subsp. japonica	Cytochrome c-type biogenesis ccda-like chloroplastic protein 2	77.741%	Swiss-Prot	strong database homology
`Q2RAR6`	Oryza sativa subsp. japonica	Cytochrome c-type biogenesis ccda-like chloroplastic protein 1	77.741%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card