TkA07G442390 | RubberDandelionOmics

Gene overview

TkA07G442390

Reference: TK1151 Chr: Chr07 Coordinates: 112080332-112082740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1739 bp · TkA07G442390|TK1151|cDNA

TATAAATACCCACAAGAACCACCTCCCTCTAATTTCATTTTTATAACTTTCAAGCAATAATCTTTTCATCACTGAAATCTCTAACTTTCAAGATCAAGATATTCATTTAATCCAAAAAGATGGCAGACAGCTGGTGGGATTCAAGAACAAGGCCTTGTTTGGATTCAGTATCTGTTACATCCATGAATCTTTTTCAAGAAAGCAGAGAAAGCACCACCGCAACAACCACCAGTGGTGGCGGCAGCGTCGGCGGAGAAGGC...

CDS

Download CDS FASTA

1269 bp · TkA07G442390|TK1151|CDS

ATGGCAGACAGCTGGTGGGATTCAAGAACAAGGCCTTGTTTGGATTCAGTATCTGTTACATCCATGAATCTTTTTCAAGAAAGCAGAGAAAGCACCACCGCAACAACCACCAGTGGTGGCGGCAGCGTCGGCGGAGAAGGCGGAGGTGGGGTGTTGGGCAACAACGCAAGTTTACAAATGATGGAATTAGGTCTTTCATCACAACCAATATCACAGTCTTTGGATTGGAACCAAGCTTTATATCGTGGAGATCAAAGAAG...

Protein

Download Protein FASTA

422 aa · TkA07G442390|TK1151|PROTEIN

MADSWWDSRTRPCLDSVSVTSMNLFQESRESTTATTTSGGGSVGGEGGGGVLGNNASLQMMELGLSSQPISQSLDWNQALYRGDQRSDHHQSGYQTLIQEDHSLSSNTSNFQEPHWKSHKIYSDSPSEFKQINVRGFRLEEPMQYDENGLNPSFQTMDDHPYGNSTVLQSLFGSDHSTNQQQDSGYDQNQGLSYNSYQSSYAGITMQSGGGGGGGSAGEYPPPPPQEFPLNSPPKVQSSNIASQLHFSNNARFWNASASS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G442390`
TK1151 ID	TkA07G442390
OH-1004 ID	LXL04_030970
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G442390

Location Chr07:112080332-112082740 (+)

Description Similar to BHLH123: Transcription factor bHLH123

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20640`	Transcription factor bHLH123.	No verified direct reference in this release
`At1g61660`	Transcription factor bHLH112.	No verified direct reference in this release
`At4g05170`	Transcription factor bHLH114.	No verified direct reference in this release
`At4g21340`	Transcription factor bHLH103.	No verified direct reference in this release
`At1g27660`	Transcription factor bHLH110.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030970 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:2000214 regulation of L-proline metabolic process Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT1G61660

ath:AT3G19500

ath:AT3G20640

ath:AT4G05170

ath:AT4G21340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · TkA07G442390 · TK1151

Cytoplasm0.082

Rank 2 · TkA07G442390 · TK1151

Cell membrane0.028

Rank 3 · TkA07G442390 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA07G442390 · TK1151

Plastid0.012

Rank 5 · TkA07G442390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15471TMEM171220-268 aa

PF00010HLH262-295 aa

PF04281Tom22294-354 aa

PF23177bHLH_IRO3316-363 aa

PF23173bHLH_SAC51317-359 aa

PF00010HLH318-355 aa

PF27761VUP_C387-399 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G442390	`PF15471`	TMEM171	220	268	4.0	7.1
TkA07G442390	`PF00010`	HLH	262	295	0.00052	20.5
TkA07G442390	`PF04281`	Tom22	294	354	0.0055	17.3
TkA07G442390	`PF23177`	bHLH_IRO3	316	363	0.0066	17.5
TkA07G442390	`PF23173`	bHLH_SAC51	317	359	0.0029	18.2
TkA07G442390	`PF00010`	HLH	318	355	0.00052	20.5
TkA07G442390	`PF27761`	VUP_C	387	399	5.4e-05	23.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXT3`	Arabidopsis thaliana	sp\|Q8GXT3\|BH123_ARATH Transcription factor bHLH123	55.500%	Swiss-Prot	Low
`Q94JL3`	Arabidopsis thaliana	sp\|Q94JL3\|BH112_ARATH Transcription factor bHLH112	57.400%	Swiss-Prot	Low
`Q9M0X8`	Arabidopsis thaliana	sp\|Q9M0X8\|BH114_ARATH Transcription factor bHLH114	59.300%	Swiss-Prot	Low
`Q8VZ22`	Arabidopsis thaliana	sp\|Q8VZ22\|BH103_ARATH Transcription factor bHLH103	57.600%	Swiss-Prot	Low
`Q9SFZ3`	Arabidopsis thaliana	sp\|Q9SFZ3\|BH110_ARATH Transcription factor bHLH110	54.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card