LXL04_030970 | RubberDandelionOmics

Gene overview

LXL04_030970

Reference: OH-1004 Chr: Chr06 Coordinates: 126036370-126038313 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · LXL04_030970|LXL04_030970|OH1004|cDNA

ATGGCAGACAGCTGGTGGGATTCAAGAACAAGGCCTTGTTTGGATTCAGTATCTGTTACATCCATGAATCTTTTTCAAGAAAGCAGAGAAAGCACCACCGCAACAACCACCAGTGGTGGCGGCAGCGTCGGCGGAGAAGGCGGAGGTGGGGTGTTGGGCAACAACGCAAGTTTACAAATGATGGAATTAGGTCTTTCATCACAACCAATATCACAGTCTTTGGATTGGAACCAAGCTTTATATCGTGGAGATCAAAGAAG...

CDS

Download CDS FASTA

1269 bp · LXL04_030970|LXL04_030970|OH1004|CDS

ATGGCAGACAGCTGGTGGGATTCAAGAACAAGGCCTTGTTTGGATTCAGTATCTGTTACATCCATGAATCTTTTTCAAGAAAGCAGAGAAAGCACCACCGCAACAACCACCAGTGGTGGCGGCAGCGTCGGCGGAGAAGGCGGAGGTGGGGTGTTGGGCAACAACGCAAGTTTACAAATGATGGAATTAGGTCTTTCATCACAACCAATATCACAGTCTTTGGATTGGAACCAAGCTTTATATCGTGGAGATCAAAGAAG...

Protein

Download Protein FASTA

422 aa · LXL04_030970|LXL04_030970|OH1004|PROTEIN

MADSWWDSRTRPCLDSVSVTSMNLFQESRESTTATTTSGGGSVGGEGGGGVLGNNASLQMMELGLSSQPISQSLDWNQALYRGDQRSDHHQSGYQTLIQEDHSLSSNTSNFQEPHWKSHKIYSDSPSEFKQINVRGFRLEEPMQYDENGLNPSFQTMDDHPYGNSTVLQSLFGSDHSTNQQQDSGYDQNQGLSYNSYQSSYAGITMQSGGGGGGGSAGEYPPPPPQEFPVNSPPKVQSSNIASQLHFSNNARFWNASASS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030970`
TK1151 ID	TkA07G442390
OH-1004 ID	LXL04_030970
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030970

Location Chr06:126036370-126038313 (+)

Description Similar to BHLH123: Transcription factor bHLH123

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20640`	Transcription factor bHLH123.	No verified direct reference in this release
`At1g61660`	Transcription factor bHLH112.	No verified direct reference in this release
`At4g21340`	Transcription factor bHLH103.	No verified direct reference in this release
`At4g05170`	Transcription factor bHLH114.	No verified direct reference in this release
`At3g19500`	Transcription factor bHLH113.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030970 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:2000214 regulation of L-proline metabolic process Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT1G61660

ath:AT3G19500

ath:AT3G20640

ath:AT4G05170

ath:AT4G21340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · LXL04_030970 · OH-1004

Cytoplasm0.082

Rank 2 · LXL04_030970 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_030970 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_030970 · OH-1004

Plastid0.012

Rank 5 · LXL04_030970 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXT3`	Arabidopsis thaliana	Transcription factor bHLH123	37.762%	Swiss-Prot	moderate database homology
`Q94JL3`	Arabidopsis thaliana	Transcription factor bHLH112	56.250%	Swiss-Prot	weak database homology
`Q8VZ22`	Arabidopsis thaliana	Transcription factor bHLH103	57.600%	Swiss-Prot	weak database homology
`Q9M0X8`	Arabidopsis thaliana	Transcription factor bHLH114	59.821%	Swiss-Prot	weak database homology
`Q9LT67`	Arabidopsis thaliana	Transcription factor bHLH113	42.169%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card