Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1867 bp · TkA07G441660|TK1151|cDNA
ATCATATGGCGTTGCTCGTTAGTATTTTCAGGAGCTGATAAGCGCCATTGATTTCTGTCATAGCCGTGGTGTTTCCCATGTGATATCAAACCGGAAAATCTACTTCTCAATGGCAATGACGATTTGAAAATCACGGATTTTGGATTCTCTGCTCTGCCGGAGCAGAAACGTTTCAGATTCTCAATGGCAACGATGGACTTACGTGGCGCCGGAGGTATTAAGGAAGAAGGGATATGACGGCGCGGTAACTGATATATGGT...
411 bp · TkA07G441660|TK1151|CDS
ATGCTTGAGAAAGGTGCCAAGTCTAGAGTTGTGCAAGTAGACTCTCAAGAAACATGGAATCTCATCACATCTAAACTTATGTATCAAGATTCTCCGATAATAGTGAATTTTACAGCAACATGGTGCATGCCCGCAACAGCAATGGAGCCATTATTTGAAGAACAAGCTTTGATACATAAAGATGCCCTGTTCTTATCCGTTGATGTGGATGAGGCGAAGGGGTTGATGAAGAAGATGAAAATAAGAGCTATGCCCACGTT...
Protein
Download Protein FASTA136 aa · TkA07G441660|TK1151|PROTEIN
MLEKGAKSRVVQVDSQETWNLITSKLMYQDSPIIVNFTATWCMPATAMEPLFEEQALIHKDALFLSVDVDEAKGLMKKMKIRAMPTFIMMTCNKNREWVVMDKVVGANPNEIKKRIAAFIHFIRKQIKNNVEVLVN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G441660 |
|---|---|
| TK1151 ID | TkA07G441660 |
| OH-1004 ID | LXL04_030963 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G441660 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:111877130-111880443 (-) | ||||||||||||
| Description | Similar to CXXS1: Thioredoxin-like protein CXXS1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0043085 positive regulation of catalytic activity Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0003756 protein disulfide isomerase activity Molecular Function GO:0008047 enzyme activator activity Molecular Function GO:0015035 protein-disulfide reductase activity Molecular Function GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT1G11530 ath:AT3G51030 dosa:Os03g0800700 dosa:Os04g0629500 dosa:Os07g0190800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04756OST3_OST66-133 aaPF00837T4_deiodinase6-73 aaPF14370Topo_C_assoc12-45 aaPF00085Thioredoxin24-117 aaPF13899Thioredoxin_729-90 aaPF13098Thioredoxin_229-91 aaPF14595Thioredoxin_930-96 aaPF13905Thioredoxin_832-54 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G441660 | PF04756 | OST3_OST6 | 6 | 133 | 5.1e-05 | 23.5 |
| TkA07G441660 | PF00837 | T4_deiodinase | 6 | 73 | 0.01 | 15.9 |
| TkA07G441660 | PF14370 | Topo_C_assoc | 12 | 45 | 0.041 | 14.4 |
| TkA07G441660 | PF00085 | Thioredoxin | 24 | 117 | 6.9e-16 | 58.8 |
| TkA07G441660 | PF13899 | Thioredoxin_7 | 29 | 90 | 0.00051 | 20.8 |
| TkA07G441660 | PF13098 | Thioredoxin_2 | 29 | 91 | 0.011 | 16.8 |
| TkA07G441660 | PF14595 | Thioredoxin_9 | 30 | 96 | 0.033 | 14.8 |
| TkA07G441660 | PF13905 | Thioredoxin_8 | 32 | 54 | 0.08 | 14.1 |
| TkA07G441660 | PF13905 | Thioredoxin_8 | 60 | 91 | 0.08 | 14.1 |
| TkA07G441660 | PF13899 | Thioredoxin_7 | 91 | 107 | 0.00051 | 20.8 |
| TkA07G441660 | PF13905 | Thioredoxin_8 | 119 | 132 | 0.08 | 14.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.