LXL04_030963 | RubberDandelionOmics

Gene overview

LXL04_030963

Reference: OH-1004 Chr: Chr06 Coordinates: 125732249-125733155 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · LXL04_030963|LXL04_030963|OH1004|cDNA

ATGCTTGAGAAAGGTGCCAAGTCTAGAGTTGTGCAAGTAGACTCTCAAGAAACATGGAATCTCATCACATCTAAACTTATGTATCAAGATTCTCCGATAATAGTGAATTTTACAGCAACATGGTGCATGCCCGCAACAGCAATGGAGCCATTATTTGAAGAACAAGCTTTGATACATAAAGACGCCCTGTTCTTATCCGTTGATGTGGATGAGGCGAAGGGgttgatgaagaagatgaaaatAAGAGCTATGCCCACGTT...

CDS

Download CDS FASTA

411 bp · LXL04_030963|LXL04_030963|OH1004|CDS

ATGCTTGAGAAAGGTGCCAAGTCTAGAGTTGTGCAAGTAGACTCTCAAGAAACATGGAATCTCATCACATCTAAACTTATGTATCAAGATTCTCCGATAATAGTGAATTTTACAGCAACATGGTGCATGCCCGCAACAGCAATGGAGCCATTATTTGAAGAACAAGCTTTGATACATAAAGACGCCCTGTTCTTATCCGTTGATGTGGATGAGGCGAAGGGGTTGATGAAGAAGATGAAAATAAGAGCTATGCCCACGTT...

Protein

Download Protein FASTA

136 aa · LXL04_030963|LXL04_030963|OH1004|PROTEIN

MLEKGAKSRVVQVDSQETWNLITSKLMYQDSPIIVNFTATWCMPATAMEPLFEEQALIHKDALFLSVDVDEAKGLMKKMKIRAMPTFIMMTCNKKREWVVMDKVVGANPNEIKKRIAAFIHFIRKQIKNNVEVLVN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030963`
TK1151 ID	TkA07G441660
OH-1004 ID	LXL04_030963
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030963

Location Chr06:125732249-125733155 (-)

Description Similar to CXXS1: Thioredoxin-like protein CXXS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11530`	Possesses low disulfide reductase activity, but efficient protein disulfide isomerase activity.	AtCXXS: atypical members of the Arabidopsis thaliana thioredoxin h family with a remarkably high disulfide isomerase activity.2008 · DOI: 10.1111/j.1399-3054.2008.01093.x
`At3g51030`	Thiol-disulfide oxidoreductase involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0629500`	Thioredoxin-like protein CXXS1.	No verified direct reference in this release
`Os03g0800700`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release
`Os07g0190800`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030963 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0043085 positive regulation of catalytic activity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003756 protein disulfide isomerase activity Molecular Function

GO:0008047 enzyme activator activity Molecular Function

GO:0015035 protein-disulfide reductase activity Molecular Function

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

KEGG gene cross-reference

ath:AT1G11530

ath:AT3G51030

dosa:Os03g0800700

dosa:Os04g0629500

dosa:Os07g0190800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.534

Rank 1 · LXL04_030963 · OH-1004

Nucleus0.333

Rank 2 · LXL04_030963 · OH-1004

Mitochondrion0.137

Rank 3 · LXL04_030963 · OH-1004

Endoplasmic reticulum0.094

Rank 4 · LXL04_030963 · OH-1004

Cell membrane0.082

Rank 5 · LXL04_030963 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin24-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030963	`PF00085.27`	Thioredoxin	24	117	7.3e-16	58.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LDI5`	Arabidopsis thaliana	Thioredoxin-like protein CXXS1	47.009%	Swiss-Prot	moderate database homology
`P29448`	Arabidopsis thaliana	Thioredoxin H1	36.036%	Swiss-Prot	moderate database homology
`Q0J9V5`	Oryza sativa subsp. japonica	Thioredoxin-like protein CXXS1	39.316%	Swiss-Prot	moderate database homology
`Q851R5`	Oryza sativa subsp. japonica	Thioredoxin H2-2	34.711%	Swiss-Prot	moderate database homology
`Q6Z4I3`	Oryza sativa subsp. japonica	Thioredoxin H2-1	33.333%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card