TkA07G441230 | RubberDandelionOmics

Gene overview

TkA07G441230

Reference: TK1151 Chr: Chr07 Coordinates: 111767810-111768124 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA07G441230|TK1151|cDNA

ATGGCTGCGAGTGTTTGTTCCTCGGTGGAAGACAACATCAATATCTCTAGCAGTAGTGGACGATGTTGTGAGGAGGAGAGTTACAGTCCTAGTGCCGACATCAGTGAGTCCGAGAGTTCTAGCGGTTTCTTTGGTTGCCGTTATAACGATGGCGCTTCTTCTAGTTCCTTGAAATCCTCTTCGTTTGCTGCCTCTCATTCGGTTTCCGGCAATGATTCTATGTTTCCGATGCCGCCGTTCTCGTTCCCACTGATTGGCGG...

CDS

Download CDS FASTA

315 bp · TkA07G441230|TK1151|CDS

ATGGCTGCGAGTGTTTGTTCCTCGGTGGAAGACAACATCAATATCTCTAGCAGTAGTGGACGATGTTGTGAGGAGGAGAGTTACAGTCCTAGTGCCGACATCAGTGAGTCCGAGAGTTCTAGCGGTTTCTTTGGTTGCCGTTATAACGATGGCGCTTCTTCTAGTTCCTTGAAATCCTCTTCGTTTGCTGCCTCTCATTCGGTTTCCGGCAATGATTCTATGTTTCCGATGCCGCCGTTCTCGTTCCCACTGATTGGCGG...

Protein

Download Protein FASTA

104 aa · TkA07G441230|TK1151|PROTEIN

MAASVCSSVEDNINISSSSGRCCEEESYSPSADISESESSSGFFGCRYNDGASSSSLKSSSFAASHSVSGNDSMFPMPPFSFPLIGGCDEVMIWDKKQPQKHPG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G441230`
TK1151 ID	TkA07G441230
OH-1004 ID	LXL04_009692
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.038 / OH-1004 16.533 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G441230

Location Chr07:111767810-111768124 (+)

Description Similar to ROPGEF1: Rop guanine nucleotide exchange factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38430`	Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.	Members of a novel class of Arabidopsis Rho guanine nucleotide exchange factors control Rho GTPase-dependent polar growth.2006 · DOI: 10.1105/tpc.105.036434 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis.2012 · DOI: 10.1016/j.febslet.2012.03.040 AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009692 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function

KEGG gene cross-reference

ath:AT3G55660

ath:AT4G00460

ath:AT4G38430

ath:AT5G02010

ath:AT5G05940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.462

Rank 1 · TkA07G441230 · TK1151

Cytoplasm0.388

Rank 2 · TkA07G441230 · TK1151

Cell membrane0.162

Rank 3 · TkA07G441230 · TK1151

Endoplasmic reticulum0.105

Rank 4 · TkA07G441230 · TK1151

Mitochondrion0.067

Rank 5 · TkA07G441230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZY2`	Arabidopsis thaliana	sp\|Q93ZY2\|ROGF1_ARATH Rop guanine nucleotide exchange factor 1	50.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card