TkA07G441050 | RubberDandelionOmics

Gene overview

TkA07G441050

Reference: TK1151 Chr: Chr07 Coordinates: 111737722-111739168 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

665 bp · TkA07G441050|TK1151|cDNA

TTATATTTGATAGAGGGGACATCTAGACATGTTAAGCAAACCACTCAGGAATCAGAACGCCCGGATCTTGGAAGTGCACGTGTTGTCATCACAGGAGGGCGAGCACTTAAAAGTGCTGAAAACTTTAAAATGATTGAAGAACTTGCTGAAAAACTTGGTGCAGCAGTTGGTGCTACTCGTGCTGCTGTTGATGCTGGATACGTTCCCAATGAGCTCCAGGTTGGGCAAACAGGGAAGATAGTTGCTCCAGAACTTTACAT...

CDS

Download CDS FASTA

399 bp · TkA07G441050|TK1151|CDS

TTATATTTGATAGAGGGGACATCTAGACATGTTAAGCAAACCACTCAGGAATCAGAACGCCCGGATCTTGGAAGTGCACGTGTTGTCATCACAGGAGGGCGAGCACTTAAAAGTGCTGAAAACTTTAAAATGATTGAAGAACTTGCTGAAAAACTTGGTGCAGCAGTTGGTGCTACTCGTGCTGCTGTTGATGCTGGATACGTTCCCAATGAGCTCCAGGTTGGGCAAACAGGGAAGATAGTTGCTCCAGAACTTTACAT...

Protein

Download Protein FASTA

132 aa · TkA07G441050|TK1151|PROTEIN

LYLIEGTSRHVKQTTQESERPDLGSARVVITGGRALKSAENFKMIEELAEKLGAAVGATRAAVDAGYVPNELQVGQTGKIVAPELYMAFGVSGAIQHIAGMRDSKVIVAVNKDADAPIFQIADYGLVGDLFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G441050`
TK1151 ID	TkA07G441050
OH-1004 ID	LXL04_030953
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 96.970 / OH-1004 36.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G441050

Location Chr07:111737722-111739168 (-)

Description Similar to ETFA: Electron transfer flavoprotein subunit alpha, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50940`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XNR6`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	No verified direct reference in this release
`Os03g0835400`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030953 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009063 amino acid catabolic process Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0045251 electron transfer flavoprotein complex Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0009055 electron transfer activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT1G50940

dosa:Os03g0835400

hsa:2108

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.700

Rank 1 · TkA07G441050 · TK1151

Nucleus0.274

Rank 2 · TkA07G441050 · TK1151

Mitochondrion0.164

Rank 3 · TkA07G441050 · TK1151

Cell membrane0.100

Rank 4 · TkA07G441050 · TK1151

Endoplasmic reticulum0.083

Rank 5 · TkA07G441050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00766ETF_alpha22-102 aa

PF00205TPP_enzyme_M25-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G441050	`PF00766`	ETF_alpha	22	102	1.8e-36	124.7
TkA07G441050	`PF00205`	TPP_enzyme_M	25	89	0.0011	19.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6I6`	Arabidopsis thaliana	sp\|Q9C6I6\|ETFA_ARATH Electron transfer flavoprotein subunit alpha, mitochondrial	88.000%	Swiss-Prot	High
`A2XNR6`	Oryza sativa subsp. indica	sp\|A2XNR6\|ETFA_ORYSI Electron transfer flavoprotein subunit alpha, mitochondrial	81.900%	Swiss-Prot	High
`Q75LJ3`	Oryza sativa subsp. japonica	sp\|Q75LJ3\|ETFA_ORYSJ Electron transfer flavoprotein subunit alpha, mitochondrial	81.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card