LXL04_030953 | RubberDandelionOmics

Gene overview

LXL04_030953

Reference: OH-1004 Chr: Chr06 Coordinates: 125595378-125598340 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1053 bp · LXL04_030953|LXL04_030953|OH1004|cDNA

ATGCTCCGAGCTATTACTCTCAGACGCTTAGTCGCACATACTCCTCGTTCAATCTCATATTGTAGACACCTTGGAACATTAGTTATAGCAGAACATGAAGGTGGTTCACTGACTGGCACTTCCCTGAGTTCAATAGAAGCTTCCAGCAAGTTCTTATGTAAAGACAACTCTTTATCATTGCTATTGGCTGGGACAGGCCCATCTTTACAAGAGGCTGCTACAAAAGCTGCTTCATGTCATCCTTCCATTTCTCAGGTGCT...

CDS

Download CDS FASTA

1053 bp · LXL04_030953|LXL04_030953|OH1004|CDS

ATGCTCCGAGCTATTACTCTCAGACGCTTAGTCGCACATACTCCTCGTTCAATCTCATATTGTAGACACCTTGGAACATTAGTTATAGCAGAACATGAAGGTGGTTCACTGACTGGCACTTCCCTGAGTTCAATAGAAGCTTCCAGCAAGTTCTTATGTAAAGACAACTCTTTATCATTGCTATTGGCTGGGACAGGCCCATCTTTACAAGAGGCTGCTACAAAAGCTGCTTCATGTCATCCTTCCATTTCTCAGGTGCT...

Protein

Download Protein FASTA

350 aa · LXL04_030953|LXL04_030953|OH1004|PROTEIN

MLRAITLRRLVAHTPRSISYCRHLGTLVIAEHEGGSLTGTSLSSIEASSKFLCKDNSLSLLLAGTGPSLQEAATKAASCHPSISQVLVADSDRFKHSLAEPWAKLIHLVQQKGDYSHIVAASGSFGKNILPRAAALLDVSPITDVIEISEPRTFVRPIYAGNALCTIRYTGSNPCMLTIRSTSFPVSASSDSKTNAAPIHQVDLSSLGEEGTSRHVKQTTQESERPDLGSARVVITGGRALKSAENFKMIEELAEKLGAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030953`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030953

Location Chr06:125595378-125598340 (-)

Description Similar to ETFA: Electron transfer flavoprotein subunit alpha, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50940`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0835400`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	No verified direct reference in this release
`UniProt: A2XNR6`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030953 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009063 amino acid catabolic process Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0045251 electron transfer flavoprotein complex Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0009055 electron transfer activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT1G50940

dosa:Os03g0835400

hsa:2108

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.921

Rank 1 · LXL04_030953 · OH-1004

Cytoplasm0.126

Rank 2 · LXL04_030953 · OH-1004

Nucleus0.073

Rank 3 · LXL04_030953 · OH-1004

Cell membrane0.028

Rank 4 · LXL04_030953 · OH-1004

Plastid0.019

Rank 5 · LXL04_030953 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01012.28ETF26-205 aa

PF00766.26ETF_alpha227-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030953	`PF01012.28`	ETF	26	205	5.7e-36	124.7
LXL04_030953	`PF00766.26`	ETF_alpha	227	307	1.3e-35	121.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6I6`	Arabidopsis thaliana	Electron transfer flavoprotein subunit alpha, mitochondrial	68.802%	Swiss-Prot	strong database homology
`Q75LJ3`	Oryza sativa subsp. japonica	Electron transfer flavoprotein subunit alpha, mitochondrial	70.149%	Swiss-Prot	strong database homology
`A2XNR6`	Oryza sativa subsp. indica	Electron transfer flavoprotein subunit alpha, mitochondrial	70.149%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card