TkA07G440700 | RubberDandelionOmics

Gene overview

TkA07G440700

Reference: TK1151 Chr: Chr07 Coordinates: 111645456-111646355 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · TkA07G440700|TK1151|cDNA

ATGTCCATCTTACCCCACCACTACCATATCCATCATGCTGCCTCCATAGGCCGCCGTCACCACTACCACCACCACCGCCACCACCGTGTCTATTGCACTGCAACAACTCCATTAAAGCCAAGGCCGAAAGTTGAGCCGCTCATCATCAACACAACACCACTCATTGCTCCACCTAAGCTCGATGACCCAGAGCTTAAGTCAAGTTGGACTCATCGCGCATGGGTGGCCACAGGATGCACCACGGTTCTAATTTCACTAGC...

CDS

Download CDS FASTA

900 bp · TkA07G440700|TK1151|CDS

ATGTCCATCTTACCCCACCACTACCATATCCATCATGCTGCCTCCATAGGCCGCCGTCACCACTACCACCACCACCGCCACCACCGTGTCTATTGCACTGCAACAACTCCATTAAAGCCAAGGCCGAAAGTTGAGCCGCTCATCATCAACACAACACCACTCATTGCTCCACCTAAGCTCGATGACCCAGAGCTTAAGTCAAGTTGGACTCATCGCGCATGGGTGGCCACAGGATGCACCACGGTTCTAATTTCACTAGC...

Protein

Download Protein FASTA

299 aa · TkA07G440700|TK1151|PROTEIN

MSILPHHYHIHHAASIGRRHHYHHHRHHRVYCTATTPLKPRPKVEPLIINTTPLIAPPKLDDPELKSSWTHRAWVATGCTTVLISLASSVVGSVDSHIWLEPVLSGFAGYLFADLGSGVYHWGIDNYGDASTPVFGSQIDAFQGHHRWPWTITKRQFANNLHALARVITYTVLPIDLIGHDHPAVMGFVGMASGCIMFSQLFHSWAHGTKSKLPPVVVVLQDAGVLVSRSQHAAHHRPPYNNNYCIVSGVWNKFLDENRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G440700`
TK1151 ID	TkA07G440700
OH-1004 ID	LXL04_030944
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.331 / OH-1004 85.100 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G440700

Location Chr07:111645456-111646355 (+)

Description Similar to FAD4: Fatty acid desaturase 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27030`	Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species containing 16:1(3E).	FATTY ACID DESATURASE4 of Arabidopsis encodes a protein distinct from characterized fatty acid desaturases.2009 · DOI: 10.1111/j.1365-313x.2009.04001.x
`At1g62190`	Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species.	No verified direct reference in this release
`At2g22890`	Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030944 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0008611 ether lipid biosynthetic process Biological Process

GO:0046471 phosphatidylglycerol metabolic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0050207 plasmanylethanolamine desaturase activity Molecular Function

GO:0102654 palmitoyl-[glycerolipid] 3-(E)-desaturase activity Molecular Function

KEGG gene cross-reference

ath:AT1G62190

ath:AT2G22890

ath:AT4G27030

hsa:387521

hsa:387522

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.533

Rank 1 · TkA07G440700 · TK1151

Mitochondrion0.266

Rank 2 · TkA07G440700 · TK1151

Endoplasmic reticulum0.086

Rank 3 · TkA07G440700 · TK1151

Nucleus0.043

Rank 4 · TkA07G440700 · TK1151

Golgi apparatus0.033

Rank 5 · TkA07G440700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04116FA_hydroxylase7-42 aa

PF10520Lipid_desat16-36 aa

PF10520Lipid_desat110-279 aa

PF04116FA_hydroxylase143-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G440700	`PF04116`	FA_hydroxylase	7	42	7.8e-05	23.8
TkA07G440700	`PF10520`	Lipid_desat	16	36	1.2e-68	231.3
TkA07G440700	`PF10520`	Lipid_desat	110	279	1.2e-68	231.3
TkA07G440700	`PF04116`	FA_hydroxylase	143	254	7.8e-05	23.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ42`	Arabidopsis thaliana	sp\|Q9SZ42\|FAD4_ARATH Fatty acid desaturase 4, chloroplastic	73.000%	Swiss-Prot	High
`O04584`	Arabidopsis thaliana	sp\|O04584\|FD4L1_ARATH Fatty acid desaturase 4-like 1, chloroplastic	58.500%	Swiss-Prot	High
`O81006`	Arabidopsis thaliana	sp\|O81006\|FD4L2_ARATH Fatty acid desaturase 4-like 2, chloroplastic	60.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card