LXL04_030944 | RubberDandelionOmics

Gene overview

LXL04_030944

Reference: OH-1004 Chr: Chr06 Coordinates: 125502553-125504497 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1050 bp · LXL04_030944|LXL04_030944|OH1004|cDNA

ATGTCCATCTTACCCCACCACTACCATATCCATCATGCTGCCTCCATAGGCCGCCGTCACCactaccaccaccaccgccaccaccgtGTCTATTGCACTGCAACAACTCCATTAAAGCCAAGGCCGAAAGTTGAGCCGCTCATCATCAACACAACACCACTCATTGCTCCACCTAAGCTCGATGACCCAGAGCTTAAGTCAAGTTGGACTCATCGCGCATGGGTGGCCACAGGATGCACCACGGTTCTAATTTCACTAGC...

CDS

Download CDS FASTA

1050 bp · LXL04_030944|LXL04_030944|OH1004|CDS

ATGTCCATCTTACCCCACCACTACCATATCCATCATGCTGCCTCCATAGGCCGCCGTCACCACTACCACCACCACCGCCACCACCGTGTCTATTGCACTGCAACAACTCCATTAAAGCCAAGGCCGAAAGTTGAGCCGCTCATCATCAACACAACACCACTCATTGCTCCACCTAAGCTCGATGACCCAGAGCTTAAGTCAAGTTGGACTCATCGCGCATGGGTGGCCACAGGATGCACCACGGTTCTAATTTCACTAGC...

Protein

Download Protein FASTA

349 aa · LXL04_030944|LXL04_030944|OH1004|PROTEIN

MSILPHHYHIHHAASIGRRHHYHHHRHHRVYCTATTPLKPRPKVEPLIINTTPLIAPPKLDDPELKSSWTHRAWVATGCTTVLISLASSVVGSVDSHIWLEPVLSGFAGYLFADLGSGVYHWGIDNYGDASTPVFGSQIDAFQGHHRWPWTITKRQFANNLHALARVITYTVLPIDLIGHDHPAVMGFVGMASGCIMFSQLFHSWAHGTKSKLPPVVVVLQDAGVLVSRSQHAAHHRPPYNNNYCIVSGVWNKFLDENRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030944`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030944

Location Chr06:125502553-125504497 (+)

Description Similar to FAD4: Fatty acid desaturase 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27030`	Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species containing 16:1(3E).	FATTY ACID DESATURASE4 of Arabidopsis encodes a protein distinct from characterized fatty acid desaturases.2009 · DOI: 10.1111/j.1365-313x.2009.04001.x
`At1g62190`	Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species.	No verified direct reference in this release
`At2g22890`	Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030944 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0008611 ether lipid biosynthetic process Biological Process

GO:0046471 phosphatidylglycerol metabolic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0050207 plasmanylethanolamine desaturase activity Molecular Function

GO:0102654 palmitoyl-[glycerolipid] 3-(E)-desaturase activity Molecular Function

KEGG gene cross-reference

ath:AT1G62190

ath:AT2G22890

ath:AT4G27030

hsa:387521

hsa:387522

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.691

Rank 1 · LXL04_030944 · OH-1004

Mitochondrion0.146

Rank 2 · LXL04_030944 · OH-1004

Endoplasmic reticulum0.080

Rank 3 · LXL04_030944 · OH-1004

Nucleus0.045

Rank 4 · LXL04_030944 · OH-1004

Golgi apparatus0.035

Rank 5 · LXL04_030944 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10520.16Lipid_desat110-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030944	`PF10520.16`	Lipid_desat	110	279	1.8e-68	230.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ42`	Arabidopsis thaliana	Fatty acid desaturase 4, chloroplastic	70.196%	Swiss-Prot	strong database homology
`O04584`	Arabidopsis thaliana	Fatty acid desaturase 4-like 1, chloroplastic	58.052%	Swiss-Prot	strong database homology
`O81006`	Arabidopsis thaliana	Fatty acid desaturase 4-like 2, chloroplastic	59.770%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card