TkA07G440540 | RubberDandelionOmics

Gene overview

TkA07G440540

Reference: TK1151 Chr: Chr07 Coordinates: 111601426-111604978 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1089 bp · TkA07G440540|TK1151|cDNA

TAAAAAGTAAAAACTACATATAGAAAAAAGAAAAAGCTACGCTGTAAACTCATATCAGGCTATCGGCGATGCTCTTATGAACTCTAAACATAGAGGTATAAAATCATATCCAAAGACGAAATAAATTCAAAACATTTCCATTTTCAAGGTTCACCGAATCCTTCTCGAACCCCAAAAGGTGTTGATTCATTTCTTGTCACCCCAGTTGTTCTTTTCACTTCTTAAGCAATTCGCACTTTCTCAGGTGCATATTAGTAATA...

CDS

Download CDS FASTA

630 bp · TkA07G440540|TK1151|CDS

ATGGAAGGTAGTAGTATAGTCAGAAGGGTGATTCCATCAGATAACAGTTGCCTCTTCAATGCTGTTGGATATGTCATGGATCATGACAAAAAAAAGGCTCCAGAATTAAGACAGGTTATAGCTGCTGCAGTATCAAGTGATCCAACAAAATACTCTGAAGCATTTCTCGGAAAACCTAATGAAGAATATTGTTCTTGGATTCTTAACCCCGAGAAATGGGGAGGTGCGATAGAGCTTTCAATATTGGCGGATTTTTATGG...

Protein

Download Protein FASTA

209 aa · TkA07G440540|TK1151|PROTEIN

MEGSSIVRRVIPSDNSCLFNAVGYVMDHDKKKAPELRQVIAAAVSSDPTKYSEAFLGKPNEEYCSWILNPEKWGGAIELSILADFYGREIAAYDIQTTRCDLYGQEKKYGERVMLIYDGLHYDALAMSPTDGAPEEFDQTIFGVNSDRTIEPYETFALNLVKDQQRKRSYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQEFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G440540`
TK1151 ID	TkA07G440540
OH-1004 ID	LXL04_030938
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G440540

Location Chr07:111601426-111604978 (+)

Description Similar to OTU2: OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50670`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	Distinct phylogenetic relationships and biochemical properties of Arabidopsis ovarian tumor-related deubiquitinases support their functional differentiation.2014 · DOI: 10.3389/fpls.2014.00084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030938 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016236 macroautophagy Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0035523 protein K29-linked deubiquitination Biological Process

GO:0035871 protein K11-linked deubiquitination Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0070536 protein K63-linked deubiquitination Biological Process

GO:0071108 protein K48-linked deubiquitination Biological Process

GO:1904153 negative regulation of retrograde protein transport, ER to cytosol Biological Process

GO:1990167 protein K27-linked deubiquitination Biological Process

GO:1990168 protein K33-linked deubiquitination Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G50670

ddi:DDB_G0271346

dre:550411

gga:428266

hsa:55432

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.678

Rank 1 · TkA07G440540 · TK1151

Cytoplasm0.639

Rank 2 · TkA07G440540 · TK1151

Mitochondrion0.061

Rank 3 · TkA07G440540 · TK1151

Cell membrane0.031

Rank 4 · TkA07G440540 · TK1151

Endoplasmic reticulum0.027

Rank 5 · TkA07G440540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02338OTU12-111 aa

PF21061Reovirus_L2_7th130-177 aa

PF17283Zn_ribbon_SprT164-191 aa

PF24560zf-C2H2_OTU1_C174-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G440540	`PF02338`	OTU	12	111	2.5e-09	38.4
TkA07G440540	`PF21061`	Reovirus_L2_7th	130	177	0.032	14.9
TkA07G440540	`PF17283`	Zn_ribbon_SprT	164	191	0.069	13.9
TkA07G440540	`PF24560`	zf-C2H2_OTU1_C	174	208	1.9e-21	76.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPT6`	Arabidopsis thaliana	sp\|Q9LPT6\|OTU2_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 2	82.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card