LXL04_030938 | RubberDandelionOmics

Gene overview

LXL04_030938

Reference: OH-1004 Chr: Chr06 Coordinates: 125461045-125463078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

650 bp · LXL04_030938|LXL04_030938|OH1004|cDNA

TTCAGGTGCATATTAGTAATAATATGGACGGTAGTATAGTCAGAAGGGTGATTCCATCAGATAACAGTTGCCTCTTCAATGCTGTTGGTTATGTCATGGTTCATGACAAAAAAAAGGCTCCAGAATTAAGACAGgTTATAGCTGCTGCAGTCTCAAGTGATCCAACAAAATACTCTGAAGCATTTCTTGGAAAACCTAATGAAGAATATTGTTCTTGGATTCTTAACCCTGAAAAATGGGGagGTGCGATAGAGCTTTCA...

CDS

Download CDS FASTA

627 bp · LXL04_030938|LXL04_030938|OH1004|CDS

ATGGACGGTAGTATAGTCAGAAGGGTGATTCCATCAGATAACAGTTGCCTCTTCAATGCTGTTGGTTATGTCATGGTTCATGACAAAAAAAAGGCTCCAGAATTAAGACAGGTTATAGCTGCTGCAGTCTCAAGTGATCCAACAAAATACTCTGAAGCATTTCTTGGAAAACCTAATGAAGAATATTGTTCTTGGATTCTTAACCCTGAAAAATGGGGAGGTGCGATAGAGCTTTCAATATTGGCGGACTTTTATGGGCG...

Protein

Download Protein FASTA

208 aa · LXL04_030938|LXL04_030938|OH1004|PROTEIN

MDGSIVRRVIPSDNSCLFNAVGYVMVHDKKKAPELRQVIAAAVSSDPTKYSEAFLGKPNEEYCSWILNPEKWGGAIELSILADFYGREIAAYDIQTTRCDLYGQEKKYGERVMLIYDGLHYDALAMSPADGAPEEFDQTIFGVNSDRTIEPYETFALNLVKDQQRKRSYTDTANFTLRCGVCQIGVIGQKEAVEHAQATGHVNFQEFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030938`
TK1151 ID	TkA07G440540
OH-1004 ID	LXL04_030938
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030938

Location Chr06:125461045-125463078 (+)

Description Similar to OTU2: OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50670`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	Distinct phylogenetic relationships and biochemical properties of Arabidopsis ovarian tumor-related deubiquitinases support their functional differentiation.2014 · DOI: 10.3389/fpls.2014.00084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030938 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016236 macroautophagy Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0035523 protein K29-linked deubiquitination Biological Process

GO:0035871 protein K11-linked deubiquitination Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0070536 protein K63-linked deubiquitination Biological Process

GO:0071108 protein K48-linked deubiquitination Biological Process

GO:1904153 negative regulation of retrograde protein transport, ER to cytosol Biological Process

GO:1990167 protein K27-linked deubiquitination Biological Process

GO:1990168 protein K33-linked deubiquitination Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G50670

ddi:DDB_G0271346

dre:550411

gga:428266

hsa:55432

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.687

Rank 1 · LXL04_030938 · OH-1004

Cytoplasm0.632

Rank 2 · LXL04_030938 · OH-1004

Mitochondrion0.060

Rank 3 · LXL04_030938 · OH-1004

Cell membrane0.030

Rank 4 · LXL04_030938 · OH-1004

Endoplasmic reticulum0.027

Rank 5 · LXL04_030938 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02338.26OTU11-110 aa

PF24560.2zf-C2H2_OTU1_C173-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030938	`PF02338.26`	OTU	11	110	8.3e-10	40.0
LXL04_030938	`PF24560.2`	zf-C2H2_OTU1_C	173	207	1.9e-21	76.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPT6`	Arabidopsis thaliana	OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 2	82.212%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card