TkA07G437060 | RubberDandelionOmics

Gene overview

TkA07G437060

Reference: TK1151 Chr: Chr07 Coordinates: 110636877-110641764 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1830 bp · TkA07G437060|TK1151|cDNA

GGAATATATGCGAATGTATGTACTGTTTCTCTGCAGCTGTTTTCTACGGCTCTGAGAAACCTAAGCGATTATGTTCATCCATTCTCCCCTAAATTCTACAAACAGATACACACAATAATCCTATGTATATGCATGTAATGTATATCTTCAAGTTTTGCCGCCAGGATCTACATAAAGATTTGTTGATCAATTAATATTCTCATACACCAAAGCATACATTTACAGAGTTTAAGTGAGGTAAATTTTGCGGCAGAATGGTT...

CDS

Download CDS FASTA

1365 bp · TkA07G437060|TK1151|CDS

ATGGTTCATACACAGTTTATTTGGTCTCACGGAGGCAATCAGGTGTTCCTGTGCGGTGATTTTACTGGGTGGATCAAGTATCAACAGATGGTTCCTGTGGAAGGATCGCCTACGACTTTCTCGACGATTTGCGATCTACCACCTGGTTTGCATAAGTTTAAATTCTTGGTGGATGGCGTATGGAGAATCAACGAGCAGCATGCGTTTGCTGAAGATGAGTATGGAGTAAACAACATCGTTCTGGTCAAACAACCAGAAGT...

Protein

Download Protein FASTA

454 aa · TkA07G437060|TK1151|PROTEIN

MVHTQFIWSHGGNQVFLCGDFTGWIKYQQMVPVEGSPTTFSTICDLPPGLHKFKFLVDGVWRINEQHAFAEDEYGVNNIVLVKQPEVMPQTLIVDDGIPIMDIDNHADDGSISTSRSIPHELVMPLRAEDIEATCNRLSDHLSSYTVYDLIPDSGKVFALDANVSVEDAFLVMHEEGLNVAPLWDETSHQISGMLTSTDFILILMELQRNHAMVANNVLELSSISAWKEGKLQLQKKPLIKVDPDETLKDVAIKILHNHI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G437060`
TK1151 ID	TkA07G437060
OH-1004 ID	LXL04_030849
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G437060

Location Chr07:110636877-110641764 (+)

Description Similar to SNF4: Sucrose nonfermenting 4-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09020`	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030849 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000266 mitochondrial fission Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009859 pollen hydration Biological Process

GO:0014873 response to muscle activity involved in regulation of muscle adaptation Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0031669 cellular response to nutrient levels Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042149 cellular response to glucose starvation Biological Process

GO:0045719 negative regulation of glycogen biosynthetic process Biological Process

GO:0045722 positive regulation of gluconeogenesis Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G09020

bta:511961

hsa:53632

mmu:241113

ssc:397149

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.523

Rank 1 · TkA07G437060 · TK1151

Cytoplasm0.491

Rank 2 · TkA07G437060 · TK1151

Cell membrane0.090

Rank 3 · TkA07G437060 · TK1151

Lysosome / Vacuole0.070

Rank 4 · TkA07G437060 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA07G437060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16561AMPK1_CBM3-86 aa

PF00571CBS156-205 aa

PF00571CBS236-266 aa

PF00571CBS288-304 aa

PF00571CBS320-371 aa

PF16561AMPK1_CBM352-362 aa

PF00571CBS384-399 aa

PF00571CBS405-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G437060	`PF16561`	AMPK1_CBM	3	86	9.7e-24	84.1
TkA07G437060	`PF00571`	CBS	156	205	6.7e-25	87.9
TkA07G437060	`PF00571`	CBS	236	266	6.7e-25	87.9
TkA07G437060	`PF00571`	CBS	288	304	6.7e-25	87.9
TkA07G437060	`PF00571`	CBS	320	371	6.7e-25	87.9
TkA07G437060	`PF16561`	AMPK1_CBM	352	362	9.7e-24	84.1
TkA07G437060	`PF00571`	CBS	384	399	6.7e-25	87.9
TkA07G437060	`PF00571`	CBS	405	449	6.7e-25	87.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944A6`	Arabidopsis thaliana	sp\|Q944A6\|SNF4_ARATH Sucrose nonfermenting 4-like protein	42.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card