LXL04_030849 | RubberDandelionOmics

Gene overview

LXL04_030849

Reference: OH-1004 Chr: Chr06 Coordinates: 124123015-124127342 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1470 bp · LXL04_030849|LXL04_030849|OH1004|cDNA

ATGGTTCATACACAGTTTATTTGGTCTCACGGAGGCAATCAGGTGTTCCTGTGCGGTGATTTTACTGGGTGGATCAAGTATCAACAGATGGTTCCTGTGGAAGGATCGTCTACGACTTTCTCGACGATTTGCGATCTACCACCTGGTTTGCATAAGTTTAAATTCTTGGTGGATGGCGTATGGAGAATCAACGAGCAGCATGCGTTTGCTGAAGATGAGTATGGAGTAAACAACATCGTTCTGGTCAAACAACCAGAAGT...

CDS

Download CDS FASTA

1470 bp · LXL04_030849|LXL04_030849|OH1004|CDS

ATGGTTCATACACAGTTTATTTGGTCTCACGGAGGCAATCAGGTGTTCCTGTGCGGTGATTTTACTGGGTGGATCAAGTATCAACAGATGGTTCCTGTGGAAGGATCGTCTACGACTTTCTCGACGATTTGCGATCTACCACCTGGTTTGCATAAGTTTAAATTCTTGGTGGATGGCGTATGGAGAATCAACGAGCAGCATGCGTTTGCTGAAGATGAGTATGGAGTAAACAACATCGTTCTGGTCAAACAACCAGAAGT...

Protein

Download Protein FASTA

489 aa · LXL04_030849|LXL04_030849|OH1004|PROTEIN

MVHTQFIWSHGGNQVFLCGDFTGWIKYQQMVPVEGSSTTFSTICDLPPGLHKFKFLVDGVWRINEQHAFAEDEYGVNNIVLVKQPEVMPQTLIVDDGIPIMDIDNHADDGSISTSRSIPHELVMPLRAEDIEATCNRLSDHLSSYTVYDLIPDSGKVRMPSFILMSVCIYLHFCHLTILNSDSDSSLTFSKVFALDANVSVEDAFLVMHEEGLNVAPLWDETSHQISGMLTSTDFILILMELQRNHAMVANNVLELSSIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030849`
TK1151 ID	TkA07G437060
OH-1004 ID	LXL04_030849
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030849

Location Chr06:124123015-124127342 (+)

Description Similar to SNF4: Sucrose nonfermenting 4-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09020`	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030849 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000266 mitochondrial fission Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009859 pollen hydration Biological Process

GO:0014873 response to muscle activity involved in regulation of muscle adaptation Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0031669 cellular response to nutrient levels Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042149 cellular response to glucose starvation Biological Process

GO:0045719 negative regulation of glycogen biosynthetic process Biological Process

GO:0045722 positive regulation of gluconeogenesis Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G09020

bta:511961

hsa:53632

mmu:241113

ssc:397149

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.491

Rank 1 · LXL04_030849 · OH-1004

Nucleus0.447

Rank 2 · LXL04_030849 · OH-1004

Cell membrane0.095

Rank 3 · LXL04_030849 · OH-1004

Lysosome / Vacuole0.088

Rank 4 · LXL04_030849 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_030849 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16561.12AMPK1_CBM3-86 aa

PF00571.34CBS355-406 aa

PF00571.34CBS440-484 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030849	`PF16561.12`	AMPK1_CBM	3	86	1.3e-23	83.7
LXL04_030849	`PF00571.34`	CBS	355	406	3.6e-25	88.7
LXL04_030849	`PF00571.34`	CBS	440	484	3.6e-25	88.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944A6`	Arabidopsis thaliana	Sucrose nonfermenting 4-like protein	38.538%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card