TkA07G432760 | RubberDandelionOmics

Gene overview

TkA07G432760

Reference: TK1151 Chr: Chr07 Coordinates: 109492335-109495935 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1635 bp · TkA07G432760|TK1151|cDNA

GAGGAATTAACATATAACAAACATCACCCTTGTAAGTTGTAACAGCTGCAGTGCCCAGACGAACTCCTCCTCCTCACCAAGAGATCCTGCACTCAATCGATCGACGCTCCGAGATTCAAAATCAGTAGCTGCAATGGAGCTGGAATTGAAAGGAATGTTAACCGATCTCCAAAAGCTCAAGAGTTCATTGTCCGATCCATCTCAACAAGCTTCTATTGATCAAATTCGATCGCGTGTAGAAAATCTCACCAGTCTCGCAA...

CDS

Download CDS FASTA

1278 bp · TkA07G432760|TK1151|CDS

ATGGAGCTGGAATTGAAAGGAATGTTAACCGATCTCCAAAAGCTCAAGAGTTCATTGTCCGATCCATCTCAACAAGCTTCTATTGATCAAATTCGATCGCGTGTAGAAAATCTCACCAGTCTCGCAATGACTGGACCAACTCGACGTACAAAACTCAAGGATATGAGCGCGGAGGTTGTAGACAGCAACCCTTACAGCAGGCTCATGGCACTACAACGGATGGGAATTGTGGACAATTATGAAAGAATCCGAGACTTTTC...

Protein

Download Protein FASTA

425 aa · TkA07G432760|TK1151|PROTEIN

MELELKGMLTDLQKLKSSLSDPSQQASIDQIRSRVENLTSLAMTGPTRRTKLKDMSAEVVDSNPYSRLMALQRMGIVDNYERIRDFSVAIVGIGGVGSVAAEMLTRCGIGRLLLYDYDTVELANMNRLFFRPDQVGMTKTDAAVQTLSEINPDVVLESFTLNITTVQGFETFIGSLKNKYFRKNKEGTGVDLVLSCVDNYEARMVVNQACNELNQTWMESGVSEDAVSGHIQLLIPGETACFACAPPLVVASGVDERTLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G432760`
TK1151 ID	TkA07G432760
OH-1004 ID	LXL04_030804
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G432760

Location Chr07:109492335-109495935 (+)

Description Similar to At1g05350: Ubiquitin-like modifier-activating enzyme 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05350`	E1-like enzyme which activates UFM1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0506500`	E1-like enzyme which activates UFM1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030804 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032649 regulation of type II interferon production Biological Process

GO:0033146 regulation of intracellular estrogen receptor signaling pathway Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0061709 reticulophagy Biological Process

GO:0071569 protein ufmylation Biological Process

GO:1990592 protein K69-linked ufmylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G05350

bta:509292

dosa:Os02g0506500

mmu:66663

rno:300968

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.598

Rank 1 · TkA07G432760 · TK1151

Nucleus0.404

Rank 2 · TkA07G432760 · TK1151

Mitochondrion0.115

Rank 3 · TkA07G432760 · TK1151

Cell membrane0.065

Rank 4 · TkA07G432760 · TK1151

Peroxisome0.052

Rank 5 · TkA07G432760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05236TAF413-55 aa

PF00899ThiF65-319 aa

PF01494FAD_binding_386-114 aa

PF02558ApbA88-136 aa

PF03435Sacchrp_dh_NADP88-122 aa

PF03435Sacchrp_dh_NADP189-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G432760	`PF05236`	TAF4	13	55	0.11	13.0
TkA07G432760	`PF00899`	ThiF	65	319	7.5e-57	192.9
TkA07G432760	`PF01494`	FAD_binding_3	86	114	0.13	12.2
TkA07G432760	`PF02558`	ApbA	88	136	0.13	12.6
TkA07G432760	`PF03435`	Sacchrp_dh_NADP	88	122	0.25	12.4
TkA07G432760	`PF03435`	Sacchrp_dh_NADP	189	212	0.25	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23034`	Arabidopsis thaliana	sp\|O23034\|UBA5_ARATH Ubiquitin-like modifier-activating enzyme 5	78.300%	Swiss-Prot	High
`Q6K6K7`	Oryza sativa subsp. japonica	sp\|Q6K6K7\|UBA5_ORYSJ Ubiquitin-like modifier-activating enzyme 5	74.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card