Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1278 bp · LXL04_030804|LXL04_030804|OH1004|cDNA
ATGGAGCTGGAATTGAAAGGAATGTTAACCGATCTCCAAAAGCTCAAGAGTTCATTGTCCGATCCATCTCAACAAGCTTCTATTGATCAAATTCGATCGCGTGTAGAAAATCTCACCAGTCTCGCAATGACTGGACCAACTCGACGTACAAAACTCAAGGATATGAGCGCGGAGGTTGTAGACAGCAACCCTTACAGCAGGCTCATGGCACTACAACGGATGGGAATTGTGGACAATTATGAAAGAATCCGAGACTTTTC...
1278 bp · LXL04_030804|LXL04_030804|OH1004|CDS
ATGGAGCTGGAATTGAAAGGAATGTTAACCGATCTCCAAAAGCTCAAGAGTTCATTGTCCGATCCATCTCAACAAGCTTCTATTGATCAAATTCGATCGCGTGTAGAAAATCTCACCAGTCTCGCAATGACTGGACCAACTCGACGTACAAAACTCAAGGATATGAGCGCGGAGGTTGTAGACAGCAACCCTTACAGCAGGCTCATGGCACTACAACGGATGGGAATTGTGGACAATTATGAAAGAATCCGAGACTTTTC...
Protein
Download Protein FASTA425 aa · LXL04_030804|LXL04_030804|OH1004|PROTEIN
MELELKGMLTDLQKLKSSLSDPSQQASIDQIRSRVENLTSLAMTGPTRRTKLKDMSAEVVDSNPYSRLMALQRMGIVDNYERIRDFSVAIVGIGGVGSVAAEMLTRCGIGRLLLYDYDTVELANMNRLFFRPDQVGMTKTDAAVQTLSEINPDVVLESFTLNITTVQGFETFIGSLKNKYFRKNKEGTGVDLVLSCVDNYEARMVVNQACNELNQTWMESGVSEDAVSGHIQLLIPGETACFACAPPLVVASGVDERTLK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_030804 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_030804 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:123040716-123043999 (+) | ||||||||||||
| Description | Similar to At1g05350: Ubiquitin-like modifier-activating enzyme 5 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0032649 regulation of type II interferon production Biological Process GO:0033146 regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0061709 reticulophagy Biological Process GO:0071569 protein ufmylation Biological Process GO:1990592 protein K69-linked ufmylation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0005524 ATP binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT1G05350 bta:509292 dosa:Os02g0506500 mmu:66663 rno:300968 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00899.28ThiF65-319 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_030804 | PF00899.28 | ThiF | 65 | 319 | 7.5e-57 | 192.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.