TkA07G431650 | RubberDandelionOmics

Gene overview

TkA07G431650

Reference: TK1151 Chr: Chr07 Coordinates: 109205895-109214502 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

915 bp · TkA07G431650|TK1151|cDNA

GAAAAACACAAGAACCACGTATAAGAGGGGGTTTAACGTGAATATATATATAGTCATGCATGCATGACTAGCTAGCTAGCCCACCGAATAACAAAGAAGCAGCATGCATCAGAACCAATCCTCCTCCTCTTCACACGCGGTTGGTCCTCCGTCGCACATGGCCAAACCGTATATTTGCAGTGATATATGCATGCGTCATCTTAGCCATTCTATATCACCAAACCACCCTTCTCTTTCACTCCACCAACACCATAGTTTCT...

CDS

Download CDS FASTA

387 bp · TkA07G431650|TK1151|CDS

ATGATTATCCGACGGATAAATTCGGTTTATTTATTTGTCGGACGATGGAGGATCGAAGCTTACATTGTTTGCTTTCACACCGAAGCTTCGGAGTTTGCAAAACAGTGGTTGCCATATTGCAAGAAGAATGGAATAATGGAGAGATGCCCTGAAGCTCATTTTCGTTCCCACTATACTCGCTTCCCTGAGACCCAAGAAATCAAGTCAATGTATGAGAAAATGAAAGTCAAAGTGGAAGAGGCAGTTGTCAGTGGAAATGT...

Protein

Download Protein FASTA

128 aa · TkA07G431650|TK1151|PROTEIN

MIIRRINSVYLFVGRWRIEAYIVCFHTEASEFAKQWLPYCKKNGIMERCPEAHFRSHYTRFPETQEIKSMYEKMKVKVEEAVVSGNVYPNEKWAHVFNHWDADFTRSNHPTVIQVLFFVGFCCLTSTK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G431650`
TK1151 ID	TkA07G431650
OH-1004 ID	LXL04_030791
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 70.312 / OH-1004 12.535 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G431650

Location Chr07:109205895-109214502 (+)

Description Similar to CSLG3: Cellulose synthase-like protein G3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55850`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At5g17420`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	Multiple cellulose synthase catalytic subunits are required for cellulose synthesis in Arabidopsis.2000 · DOI: 10.1105/tpc.12.12.2529 Structure of cellulose-deficient secondary cell walls from the irx3 mutant of Arabidopsis thaliana.2002 · DOI: 10.1016/s0031-9422(02)00199-1 Impairment of cellulose synthases required for Arabidopsis secondary cell wall formation enhances disease resistance.2007 · DOI: 10.1105/tpc.106.048058
`At4g32410`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	Fractionation of carbohydrates in Arabidopsis root cell walls shows that three radial swelling loci are specifically involved in cellulose production.2000 · DOI: 10.1007/s004250000301 PROCUSTE1 encodes a cellulose synthase required for normal cell elongation specifically in roots and dark-grown hypocotyls of Arabidopsis.2000 · DOI: 10.1105/tpc.12.12.2409 Morphology of rsw1, a cellulose-deficient mutant of Arabidopsis thaliana.2001 · DOI: 10.1007/bf01280308 Wall architecture in the cellulose-deficient rsw1 mutant of Arabidopsis thaliana: microfibrils but not microtubules lose their transverse alignment before microfibrils become unrecognizable in the mitotic and elongation zones of roots.2001 · DOI: 10.1007/bf01280312 Alpha-glucosidase I is required for cellulose biosynthesis and morphogenesis in Arabidopsis.2002 · DOI: 10.1083/jcb.200111093 Functional analysis of the cellulose synthase genes CesA1, CesA2, and CesA3 in Arabidopsis.2002 · DOI: 10.1104/pp.010931 Genetic complexity of cellulose synthase a gene function in Arabidopsis embryogenesis.2002 · DOI: 10.1104/pp.102.010603 Genetic evidence for three unique components in primary cell-wall cellulose synthase complexes in Arabidopsis.2007 · DOI: 10.1073/pnas.0706592104 Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104 Molecular analysis of cellulose biosynthesis in Arabidopsis.1998 · DOI: 10.1126/science.279.5351.717

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0725300`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os07g0424400`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030791 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016759 cellulose synthase activity Molecular Function

GO:0016760 cellulose synthase (UDP-forming) activity Molecular Function

KEGG gene cross-reference

ath:AT1G55850

ath:AT4G23990

ath:AT4G24000

ath:AT4G24010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.902

Rank 1 · TkA07G431650 · TK1151

Cytoplasm0.081

Rank 2 · TkA07G431650 · TK1151

Nucleus0.065

Rank 3 · TkA07G431650 · TK1151

Cell membrane0.022

Rank 4 · TkA07G431650 · TK1151

Plastid0.013

Rank 5 · TkA07G431650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552Cellulose_synt27-117 aa

PF23661SHMOOSE92-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G431650	`PF03552`	Cellulose_synt	27	117	2.2e-10	40.4
TkA07G431650	`PF23661`	SHMOOSE	92	110	0.21	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZK9`	Arabidopsis thaliana	sp\|Q8VZK9\|CSLE1_ARATH Cellulose synthase-like protein E1	39.400%	Swiss-Prot	Medium
`Q9SWW6`	Arabidopsis thaliana	sp\|Q9SWW6\|CESA7_ARATH Cellulose synthase A catalytic subunit 7 [UDP-forming]	33.700%	Swiss-Prot	Medium
`O48946`	Arabidopsis thaliana	sp\|O48946\|CESA1_ARATH Cellulose synthase A catalytic subunit 1 [UDP-forming]	34.600%	Swiss-Prot	Medium
`Q0DXZ1`	Oryza sativa subsp. japonica	sp\|Q0DXZ1\|CSLE2_ORYSJ Cellulose synthase-like protein E2	35.900%	Swiss-Prot	Medium
`Q69V23`	Oryza sativa subsp. japonica	sp\|Q69V23\|CESA3_ORYSJ Probable cellulose synthase A catalytic subunit 3 [UDP-forming]	34.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card