TkA07G429610 | RubberDandelionOmics

Gene overview

TkA07G429610

Reference: TK1151 Chr: Chr07 Coordinates: 108745008-108746857 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1765 bp · TkA07G429610|TK1151|cDNA

TTTTTTGCTTATATTTTGTATTTTTTTCAAGTTTTTGGGGCCCAATTTTCTACAAACCGAACAGGGGCCTCTAAATCTCCCGGCCGGCCCTGTCTCTTGAAGCATATGCGAAGCAAGCCATGTTGAAATCAACCATTGCCCCCATGCTATCTACCCTCCACCCGCAAAAGCTATTCCCCATCAAGCTCGCGTCTTTTTCTACTGCATTACCACGGGCACGAAGTCCGCCAACTGTTCGACAAAATGCCTCAACCAACACT...

CDS

Download CDS FASTA

1446 bp · TkA07G429610|TK1151|CDS

ATGTTGAAATCAACCATTGCCCCCATGCTATCTACCCTCCACCCGCAAAAGCTATTCCCCATCAAGCTCGCGTCTTTTTCTACTGCATTACCACGGGCACGAAGTCCGCCAACTGTTCGACAAAATGCCTCAACCAACACTCCAATTCTCGAGACCCCGTCCTACAAACTCCCTCCAGCTTCAGCCTACGTCCACCTCCCTTTCTGCCGCAAACGCTGCCATTATTGCGACTTTCCAATACTAGCCCTGGGTTTATCTTC...

Protein

Download Protein FASTA

481 aa · TkA07G429610|TK1151|PROTEIN

MLKSTIAPMLSTLHPQKLFPIKLASFSTALPRARSPPTVRQNASTNTPILETPSYKLPPASAYVHLPFCRKRCHYCDFPILALGLSSTETADDDPRISNYIHLLIREIEATETKFTQHPPLETVFFGGGTPSLVPPRLVAKVLDTLRSKFGLCLDAEISMEMDPGTFDAKKLTELMELGVNRVSLGVQAFQEELLKACGRAHGIDEVHEAIDIIGSCGVRNWSMDLISSLPHQTQEMWEQSLNLTIKANPNHVSIYDLQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G429610`
TK1151 ID	TkA07G429610
OH-1004 ID	LXL04_030768
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G429610`
Location	Chr07:108745008-108746857 (-)
Description	Similar to hemW: Heme chaperone HemW (Synechocystis sp. (strain PCC 6803 / Kazusa)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030768` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006779 porphyrin-containing compound biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0004109 coproporphyrinogen oxidase activity Molecular Function GO:0020037 heme binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function
KEGG gene cross-reference	bsu:BSU25500 ecj:JW2922 eco:b2955 ecoc:C3026_16170 hin:HI_0463 lla:L0193 syn:sll1917 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.757

Rank 1 · TkA07G429610 · TK1151

Mitochondrion0.296

Rank 2 · TkA07G429610 · TK1151

Cytoplasm0.041

Rank 3 · TkA07G429610 · TK1151

Nucleus0.031

Rank 4 · TkA07G429610 · TK1151

Peroxisome0.010

Rank 5 · TkA07G429610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04055Radical_SAM63-244 aa

PF00977His_biosynth157-225 aa

PF16371MetallophosN255-299 aa

PF06969HemN_C383-423 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G429610	`PF04055`	Radical_SAM	63	244	8e-25	88.6
TkA07G429610	`PF00977`	His_biosynth	157	225	0.031	14.4
TkA07G429610	`PF16371`	MetallophosN	255	299	0.037	14.9
TkA07G429610	`PF06969`	HemN_C	383	423	0.092	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card