Gene Card
Gene overview
cDNA / CDS / Protein Sequences
627 bp · TkA07G421820|TK1151|cDNA
ATGGCAGAAGTAAGTGAACAGGGCTTAAAACTGGACCAAAAAGTATCCATAATCACCGGCGGTTCAAGCGGGATCGGAGAAGCAGCTGCGCGTCTTTTCGCCAAACACGGCGCACTCGTAGTCATCGCAGACATCGAAGACCTAACTCAGTTCGACCGCCTCTACGCCATCAACGCCCGTGGAACCGCCGCATGCGTGAAGCACGCAGCGCTTGCGATGGTGGAGAAACATGTGAGAGGAAGCATTATCTGCACGGGGAG...
627 bp · TkA07G421820|TK1151|CDS
ATGGCAGAAGTAAGTGAACAGGGCTTAAAACTGGACCAAAAAGTATCCATAATCACCGGCGGTTCAAGCGGGATCGGAGAAGCAGCTGCGCGTCTTTTCGCCAAACACGGCGCACTCGTAGTCATCGCAGACATCGAAGACCTAACTCAGTTCGACCGCCTCTACGCCATCAACGCCCGTGGAACCGCCGCATGCGTGAAGCACGCAGCGCTTGCGATGGTGGAGAAACATGTGAGAGGAAGCATTATCTGCACGGGGAG...
Protein
Download Protein FASTA208 aa · TkA07G421820|TK1151|PROTEIN
MAEVSEQGLKLDQKVSIITGGSSGIGEAAARLFAKHGALVVIADIEDLTQFDRLYAINARGTAACVKHAALAMVEKHVRGSIICTGSIAASRGGSSRTDYVMAKHAVLGLVRSASKQLGMHGIRVNCVSPSAVVTALSKRSPEATKKTMKVYGALSSLKGVELTVDRVAEAVLFLASESSSFITGLDLVVDGGLTKLPDEDDMIMYNV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G421820 |
|---|---|
| TK1151 ID | TkA07G421820 |
| OH-1004 ID | LXL04_030659 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 76.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G421820 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:106627538-106628353 (-) | |||||||||
| Description | Similar to NEPS1: (+)-cis,trans-nepetalactol synthase NEPS1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0016099 monoterpenoid biosynthetic process Biological Process GO:0031525 menthol biosynthetic process Biological Process GO:0044283 small molecule biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function GO:0016853 isomerase activity Molecular Function GO:0018458 isopiperitenol dehydrogenase activity Molecular Function GO:0018459 carveol dehydrogenase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ag:AAU20370 ag:AXF35971 ag:AXF35972 ag:AXF35973 ath:AT2G47140 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00155Aminotran_1_27-44 aaPF00106adh_short14-46 aaPF08659KR17-40 aaPF13561adh_short_C223-47 aaPF00106adh_short48-143 aaPF13561adh_short_C249-195 aaPF08659KR80-126 aaPF00155Aminotran_1_2104-206 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G421820 | PF00155 | Aminotran_1_2 | 7 | 44 | 2e-05 | 24.7 |
| TkA07G421820 | PF00106 | adh_short | 14 | 46 | 2.6e-24 | 86.5 |
| TkA07G421820 | PF08659 | KR | 17 | 40 | 0.013 | 16.2 |
| TkA07G421820 | PF13561 | adh_short_C2 | 23 | 47 | 2.4e-39 | 136.1 |
| TkA07G421820 | PF00106 | adh_short | 48 | 143 | 2.6e-24 | 86.5 |
| TkA07G421820 | PF13561 | adh_short_C2 | 49 | 195 | 2.4e-39 | 136.1 |
| TkA07G421820 | PF08659 | KR | 80 | 126 | 0.013 | 16.2 |
| TkA07G421820 | PF00155 | Aminotran_1_2 | 104 | 206 | 2e-05 | 24.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.