TkA07G411170 | RubberDandelionOmics

Gene overview

TkA07G411170

Reference: TK1151 Chr: Chr07 Coordinates: 103894828-103895587 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · TkA07G411170|TK1151|cDNA

ATGTGTTTGACAAAGCACTTGTTCAGTTACGGTTCTAACAGATATAATCACCCTCCAGATCGTAGTAACAAAGCTGGAGGAGCTGCAAGAAGCGCAGGAGGGGGAGCTTACCCAGAGCGACCAGGAGAGCCTCCTTGCCAGTATTATTTAAGAACAGGCACCTGTAAATTTGGTGCATCCTGCAAGTTCAACCATCCAAGACATGCAGGTGGATCATTAAGCAGCGTGCCACTAAATACTTATGGATATCCATTAAGAGG...

CDS

Download CDS FASTA

318 bp · TkA07G411170|TK1151|CDS

ATGTGTTTGACAAAGCACTTGTTCAGTTACGGTTCTAACAGATATAATCACCCTCCAGATCGTAGTAACAAAGCTGGAGGAGCTGCAAGAAGCGCAGGAGGGGGAGCTTACCCAGAGCGACCAGGAGAGCCTCCTTGCCAGTATTATTTAAGAACAGGCACCTGTAAATTTGGTGCATCCTGCAAGTTCAACCATCCAAGACATGCAGGTGGATCATTAAGCAGCGTGCCACTAAATACTTATGGATATCCATTAAGAGG...

Protein

Download Protein FASTA

105 aa · TkA07G411170|TK1151|PROTEIN

MCLTKHLFSYGSNRYNHPPDRSNKAGGAARSAGGGAYPERPGEPPCQYYLRTGTCKFGASCKFNHPRHAGGSLSSVPLNTYGYPLRGLVLKDETRGFMHSCFWCI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G411170`
TK1151 ID	TkA07G411170
OH-1004 ID	LXL04_031558
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 72.381 / OH-1004 34.545 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G411170

Location Chr07:103894828-103895587 (+)

Description Similar to At2g47850: Zinc finger CCCH domain-containing protein 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47850`	Zinc finger CCCH domain-containing protein 32.	No verified direct reference in this release
`At3g02830`	Zinc finger CCCH domain-containing protein 33.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0258700`	Zinc finger CCCH domain-containing protein 6.	No verified direct reference in this release
`Os01g0257400`	Zinc finger CCCH domain-containing protein 5.	No verified direct reference in this release
`Os01g0917400`	Zinc finger CCCH domain-containing protein 12.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031558 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G47850

dosa:Os11g0472000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.635

Rank 1 · TkA07G411170 · TK1151

Cytoplasm0.426

Rank 2 · TkA07G411170 · TK1151

Mitochondrion0.054

Rank 3 · TkA07G411170 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA07G411170 · TK1151

Cell membrane0.038

Rank 5 · TkA07G411170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18044zf-CCCH_410-17 aa

PF00642zf-CCCH14-19 aa

PF14608zf-CCCH_214-18 aa

PF25586zf-CCCH_PAN315-19 aa

PF00642zf-CCCH41-67 aa

PF29102Su_sable_N43-72 aa

PF18044zf-CCCH_444-66 aa

PF14608zf-CCCH_245-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G411170	`PF18044`	zf-CCCH_4	10	17	2.8e-05	24.5
TkA07G411170	`PF00642`	zf-CCCH	14	19	4.2e-12	46.4
TkA07G411170	`PF14608`	zf-CCCH_2	14	18	3.2e-05	25.0
TkA07G411170	`PF25586`	zf-CCCH_PAN3	15	19	1.2	9.6
TkA07G411170	`PF00642`	zf-CCCH	41	67	4.2e-12	46.4
TkA07G411170	`PF29102`	Su_sable_N	43	72	0.29	12.2
TkA07G411170	`PF18044`	zf-CCCH_4	44	66	2.8e-05	24.5
TkA07G411170	`PF14608`	zf-CCCH_2	45	66	3.2e-05	25.0
TkA07G411170	`PF18345`	zf_CCCH_4	46	65	1.4e-06	28.9
TkA07G411170	`PF25585`	zf-CCCH_DUS3L	46	65	0.00054	20.6
TkA07G411170	`PF25586`	zf-CCCH_PAN3	53	67	1.2	9.6
TkA07G411170	`PF29102`	Su_sable_N	91	104	0.29	12.2
TkA07G411170	`PF00642`	zf-CCCH	97	100	4.2e-12	46.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W91`	Arabidopsis thaliana	sp\|Q84W91\|C3H32_ARATH Zinc finger CCCH domain-containing protein 32	81.300%	Swiss-Prot	Low
`Q8GXX7`	Arabidopsis thaliana	sp\|Q8GXX7\|C3H33_ARATH Zinc finger CCCH domain-containing protein 33	72.700%	Swiss-Prot	Low
`Q5NAW2`	Oryza sativa subsp. japonica	sp\|Q5NAW2\|C3H6_ORYSJ Zinc finger CCCH domain-containing protein 6	54.200%	Swiss-Prot	Low
`Q5NAV3`	Oryza sativa subsp. japonica	sp\|Q5NAV3\|C3H5_ORYSJ Zinc finger CCCH domain-containing protein 5	51.100%	Swiss-Prot	Low
`Q5JLB5`	Oryza sativa subsp. japonica	sp\|Q5JLB5\|C3H12_ORYSJ Zinc finger CCCH domain-containing protein 12	59.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card