LXL04_031558 | RubberDandelionOmics

Gene overview

LXL04_031558

Reference: OH-1004 Chr: Chr07 Coordinates: 7648475-7650988 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_031558|LXL04_031558|OH1004|cDNA

ATGGAGCTGTACGGACGGAGCACAGGGAGAAACGGGTCACAGCCGGATAATAATCAACATCCCGAATGGGTGCAGCCGGGGACGGAGACGGGGCTGGAAGAACTGGGACATGTGGATATGGCTGGAGGAGCTGCAAGAAGCGCAGGAGGGGGAGCTTACCCAGAGCGACCAGGAGAGCCTCCTTGCCAGTATTATTTAAGAACAGGCACCTGTAAATTTGGTGCATCCTGCAAGTTCAACCATCCAAGACATGCAGGTGG...

CDS

Download CDS FASTA

663 bp · LXL04_031558|LXL04_031558|OH1004|CDS

ATGGAGCTGTACGGACGGAGCACAGGGAGAAACGGGTCACAGCCGGATAATAATCAACATCCCGAATGGGTGCAGCCGGGGACGGAGACGGGGCTGGAAGAACTGGGACATGTGGATATGGCTGGAGGAGCTGCAAGAAGCGCAGGAGGGGGAGCTTACCCAGAGCGACCAGGAGAGCCTCCTTGCCAGTATTATTTAAGAACAGGCACCTGTAAATTTGGTGCATCCTGCAAGTTCAACCATCCAAGACATGCAGGTGG...

Protein

Download Protein FASTA

220 aa · LXL04_031558|LXL04_031558|OH1004|PROTEIN

MELYGRSTGRNGSQPDNNQHPEWVQPGTETGLEELGHVDMAGGAARSAGGGAYPERPGEPPCQYYLRTGTCKFGASCKFNHPRHAGGSLSNVPLNTYGYPLRGLVLKDETRGFMHTSICTSLLGNKLTEVTETHHLQQPTVFSDQNTPPINVRLYGSAWEIIFVKVSGKPSLGLHNVPSEHGERRMDGDNQTMKVYKTAHHGDVDDDHVADKYGGYYVEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031558`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031558

Location Chr07:7648475-7650988 (-)

Description Similar to At2g47850: Zinc finger CCCH domain-containing protein 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47850`	Zinc finger CCCH domain-containing protein 32.	No verified direct reference in this release
`At3g02830`	Zinc finger CCCH domain-containing protein 33.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0472000`	Zinc finger CCCH domain-containing protein 63.	No verified direct reference in this release
`Os01g0917400`	Zinc finger CCCH domain-containing protein 12.	No verified direct reference in this release
`Os12g0405100`	Zinc finger CCCH domain-containing protein 66.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031558 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G47850

dosa:Os11g0472000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.687

Rank 1 · LXL04_031558 · OH-1004

Cytoplasm0.316

Rank 2 · LXL04_031558 · OH-1004

Cell membrane0.049

Rank 3 · LXL04_031558 · OH-1004

Endoplasmic reticulum0.039

Rank 4 · LXL04_031558 · OH-1004

Mitochondrion0.034

Rank 5 · LXL04_031558 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00642.31zf-CCCH57-83 aa

PF18345.8zf_CCCH_462-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031558	`PF00642.31`	zf-CCCH	57	83	6.4e-12	45.8
LXL04_031558	`PF18345.8`	zf_CCCH_4	62	81	4.8e-06	27.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W91`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 32	42.754%	Swiss-Prot	weak database homology
`Q8GXX7`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 33	42.202%	Swiss-Prot	weak database homology
`Q2R4J4`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 63	45.918%	Swiss-Prot	weak database homology
`Q5JLB5`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 12	40.000%	Swiss-Prot	moderate database homology
`Q2QT65`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 66	43.434%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card