TkA07G409860 | RubberDandelionOmics

Gene overview

TkA07G409860

Reference: TK1151 Chr: Chr07 Coordinates: 103479410-103481898 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1811 bp · TkA07G409860|TK1151|cDNA

GTCCCAACTGATCTTAACACACACACATACACACACATCATATCGAGCAAATCAGACGGCTGAGGTAACAGATTCACTCGGTGGAGCAACACCATCAGTGCTCCTATCAACCCCTGTTCCTGTACCACACTGTTACAAGCATAAAAACAAACATCCATAAAGATGGTTTCGAAAAATTAAATCAAGTGGTCATTCTTCTTTGCCCCTTCACCAACTATTCTTTCATATTTCCCCCTTTTCTTTTCTTCTACCTTTTTTAG...

CDS

Download CDS FASTA

966 bp · TkA07G409860|TK1151|CDS

ATGGATGAAAGTGGGCACCGTGAAAACGGTCGGCAAAAACCGCCACAAAGTCAATGGCTAATGCAACATCAGCCATCAATGAAACAAATAATGACAATCATGGCGGAACGCGATGCCGCCATCCAAGAACGGAATCTCGCAATCTCCGAGAAAAAAGCCGCATTAGCCGAACGCGACATGGCACTCCTCCAACGCGATTCCGCCATCCAAGAACGTAACACCGCCATCATGGAACGCGATAACGCCATCACCACGCTCCA...

Protein

Download Protein FASTA

321 aa · TkA07G409860|TK1151|PROTEIN

MDESGHRENGRQKPPQSQWLMQHQPSMKQIMTIMAERDAAIQERNLAISEKKAALAERDMALLQRDSAIQERNTAIMERDNAITTLQYRENNSISNNNSISISNNNSNNNTLSPCPPGCQISRSVKHVHHPHTYLHHEIVGVGITDSIPTSPPESKTRRVKRPKDTKPKKSSKKVKMECDDLNKAMFDEPHDWNNKAGSGGDDSGVKPEWKEQELGLNHIAFDESTMPIPVCSCTGFLRPCYKWGNGGWQSSCCTTTMSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G409860`
TK1151 ID	TkA07G409860
OH-1004 ID	LXL04_030528
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 98.131 / OH-1004 93.994 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G409860

Location Chr07:103479410-103481898 (+)

Description Similar to BPC6: Protein BASIC PENTACYSTEINE6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42520`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`At2g21240`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`At4g38910`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`At1g14685`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0130600`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030528 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009723 response to ethylene Biological Process

GO:0050793 regulation of developmental process Biological Process

GO:0080157 regulation of plant-type cell wall organization or biogenesis Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001222 transcription corepressor binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G14685

ath:AT2G21240

ath:AT4G38910

ath:AT5G42520

dosa:Os06g0130600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.863

Rank 1 · TkA07G409860 · TK1151

Cytoplasm0.215

Rank 2 · TkA07G409860 · TK1151

Cell membrane0.034

Rank 3 · TkA07G409860 · TK1151

Mitochondrion0.030

Rank 4 · TkA07G409860 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA07G409860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06217GAGA_bind1-315 aa

PF27921MIPOL1_C29-42 aa

PF27921MIPOL1_C49-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G409860	`PF06217`	GAGA_bind	1	315	6.6e-104	348.9
TkA07G409860	`PF27921`	MIPOL1_C	29	42	0.37	11.5
TkA07G409860	`PF27921`	MIPOL1_C	49	107	0.37	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L999`	Arabidopsis thaliana	sp\|Q8L999\|BPC6_ARATH Protein BASIC PENTACYSTEINE6	62.600%	Swiss-Prot	High
`Q8S8C6`	Arabidopsis thaliana	sp\|Q8S8C6\|BPC4_ARATH Protein BASIC PENTACYSTEINE4	54.300%	Swiss-Prot	Medium
`F4JUI3`	Arabidopsis thaliana	sp\|F4JUI3\|BPC5_ARATH Protein BASIC PENTACYSTEINE5	56.600%	Swiss-Prot	Medium
`Q9LDE2`	Arabidopsis thaliana	sp\|Q9LDE2\|BPC2_ARATH Protein BASIC PENTACYSTEINE2	52.200%	Swiss-Prot	Low
`Q5VSA8`	Oryza sativa subsp. japonica	sp\|Q5VSA8\|BBRD_ORYSJ Barley B recombinant-like protein D	51.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card