TkA07G408620 | RubberDandelionOmics

Gene overview

TkA07G408620

Reference: TK1151 Chr: Chr07 Coordinates: 102796759-102801652 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1620 bp · TkA07G408620|TK1151|cDNA

TGTGAATCACTAGAGTGATTGACACTATTTGTCATTTGCATCCAACAAGAACACCTAGTGAATTTCGAGATTCTCTATACAAATTCCAATCAAAACTCCAACAACATTCATCAATTCCTCATTTCAAACCCAACCCACTACGAAAGTCAACCTTTTGATGCTTACGGAGTTGACTTGAGAGGTCTTGGTTCATACCATCATCACTCTCTCAATGTACTTCCCTCCATTCAGTCTCTCGGCGAAAGAATCTCGAGATCCAT...

CDS

Download CDS FASTA

1011 bp · TkA07G408620|TK1151|CDS

ATGGCGGAAGAACACGAACTTAACCAACACCACCATAACCAGAAACTCTCACTTTCTTTAGGTTCCGGTTTGCTCTTTCCTTCCTCAACGCAATACAGAGGAGAACGATGTTACTTGGTTTCCGAAGAAGAATTGCAAGAAAAAACAAGAAAGTTTCATAATCATAACCCTTCTGATTATTCTTCTTCTTCTTCCACGTTTTATGGTACAGAATCGCTCTCGATATCGGTTAACAATTCGAGGTACCTAAAACCAACTCA...

Protein

Download Protein FASTA

336 aa · TkA07G408620|TK1151|PROTEIN

MAEEHELNQHHHNQKLSLSLGSGLLFPSSTQYRGERCYLVSEEELQEKTRKFHNHNPSDYSSSSSTFYGTESLSISVNNSRYLKPTQSLLEEVVSVGGKDLDSSNKSYACKLSCSGRQGSLGLCSELKAELCSNGLPLEKQELQSTLAKLISLLEEVERRYEQYYQQVEDAVSSFEMNAGLGSGKSYTALALNAMSGHFSSLKDAILTQIYATRKKLLQDLPRMGFSQLSLFDKENNRHNRIALQQLGMIASPRQTWRPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G408620`
TK1151 ID	TkA07G408620
OH-1004 ID	LXL04_030504
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 82.555 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G408620

Location Chr07:102796759-102801652 (-)

Description Similar to BLH11: BEL1-like homeodomain protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75430`	BEL1-like homeodomain protein 11.	No verified direct reference in this release
`At1g75410`	Transcription factor involved in the nuclear import of SHOOT MERISTEMLESS (STM).	No verified direct reference in this release
`At1g19700`	BEL1-like homeodomain protein 10.	No verified direct reference in this release
`At2g16400`	BEL1-like homeodomain protein 7.	No verified direct reference in this release
`At2g35940`	BEL1-like homeodomain protein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030504 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G19700

ath:AT1G75410

ath:AT1G75430

ath:AT2G16400

ath:AT4G34610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · TkA07G408620 · TK1151

Cytoplasm0.135

Rank 2 · TkA07G408620 · TK1151

Cell membrane0.033

Rank 3 · TkA07G408620 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA07G408620 · TK1151

Plastid0.014

Rank 5 · TkA07G408620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06295ZapG-like6-65 aa

PF07526POX77-206 aa

PF06295ZapG-like139-175 aa

PF05920Homeobox_KN274-313 aa

PF00046Homeodomain281-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G408620	`PF06295`	ZapG-like	6	65	0.026	15.3
TkA07G408620	`PF07526`	POX	77	206	2.1e-35	122.9
TkA07G408620	`PF06295`	ZapG-like	139	175	0.026	15.3
TkA07G408620	`PF05920`	Homeobox_KN	274	313	2.3e-19	69.7
TkA07G408620	`PF00046`	Homeodomain	281	313	1e-07	32.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PFD1`	Arabidopsis thaliana	sp\|Q1PFD1\|BLH11_ARATH BEL1-like homeodomain protein 11	55.300%	Swiss-Prot	High
`Q9FWS9`	Arabidopsis thaliana	sp\|Q9FWS9\|BLH3_ARATH BEL1-like homeodomain protein 3	52.600%	Swiss-Prot	High
`Q9FXG8`	Arabidopsis thaliana	sp\|Q9FXG8\|BLH10_ARATH BEL1-like homeodomain protein 10	52.800%	Swiss-Prot	High
`Q9SIW1`	Arabidopsis thaliana	sp\|Q9SIW1\|BLH7_ARATH BEL1-like homeodomain protein 7	49.100%	Swiss-Prot	Medium
`Q9SJ56`	Arabidopsis thaliana	sp\|Q9SJ56\|BLH1_ARATH BEL1-like homeodomain protein 1	46.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card