LXL04_030504 | RubberDandelionOmics

Gene overview

LXL04_030504

Reference: OH-1004 Chr: Chr06 Coordinates: 117413845-117415317 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1224 bp · LXL04_030504|LXL04_030504|OH1004|cDNA

ATGGTGTCACCAGATTCCAATCAAAACTCCAACAACATTCATCAATTCCTCATTTCAAACCCAACCcactacgaaagtcaacctTTTGATGCTTACGGAGTTGACTTGAGAGGTCTTGGTTCATACCATCATCACTCTCTCAATGTACTTCCCTCCATTCAGTCTCTCGGCGAAAGAATCTCGAGATCCATTGATCTTATTCAAGCTCCTTCAATGGCGGAAGAACACGAACTTAACCAACACCACCATAACCAGAAACT...

CDS

Download CDS FASTA

1224 bp · LXL04_030504|LXL04_030504|OH1004|CDS

ATGGTGTCACCAGATTCCAATCAAAACTCCAACAACATTCATCAATTCCTCATTTCAAACCCAACCCACTACGAAAGTCAACCTTTTGATGCTTACGGAGTTGACTTGAGAGGTCTTGGTTCATACCATCATCACTCTCTCAATGTACTTCCCTCCATTCAGTCTCTCGGCGAAAGAATCTCGAGATCCATTGATCTTATTCAAGCTCCTTCAATGGCGGAAGAACACGAACTTAACCAACACCACCATAACCAGAAACT...

Protein

Download Protein FASTA

407 aa · LXL04_030504|LXL04_030504|OH1004|PROTEIN

MVSPDSNQNSNNIHQFLISNPTHYESQPFDAYGVDLRGLGSYHHHSLNVLPSIQSLGERISRSIDLIQAPSMAEEHELNQHHHNQKLSLSLGSGLLFPSSTQYRGERCYLVSEEELQEKTRKFHNHNPSDYSSSSSTFYGTESLSISVNNSRYLKPTQSLLEEVVSVGGKDLDSSNKSYACKLSCSGRQGSLGLCSELKAELCSNGLPLEKQELQSTLAKLISLLEEVERRYEQYYQQVEDAVSSFEMNAGLGSGKSYTA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030504`
TK1151 ID	TkA07G408620
OH-1004 ID	LXL04_030504
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 82.555 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030504

Location Chr06:117413845-117415317 (-)

Description Similar to BLH11: BEL1-like homeodomain protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75430`	BEL1-like homeodomain protein 11.	No verified direct reference in this release
`At1g75410`	Transcription factor involved in the nuclear import of SHOOT MERISTEMLESS (STM).	No verified direct reference in this release
`At1g19700`	BEL1-like homeodomain protein 10.	No verified direct reference in this release
`At2g16400`	BEL1-like homeodomain protein 7.	No verified direct reference in this release
`At4g34610`	BEL1-like homeodomain protein 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030504 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G19700

ath:AT1G75410

ath:AT1G75430

ath:AT2G16400

ath:AT4G34610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · LXL04_030504 · OH-1004

Cytoplasm0.120

Rank 2 · LXL04_030504 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_030504 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_030504 · OH-1004

Plastid0.014

Rank 5 · LXL04_030504 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07526.17POX148-277 aa

PF05920.18Homeobox_KN345-384 aa

PF00046.36Homeodomain352-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030504	`PF07526.17`	POX	148	277	2.9e-35	122.5
LXL04_030504	`PF05920.18`	Homeobox_KN	345	384	2.9e-19	69.3
LXL04_030504	`PF00046.36`	Homeodomain	352	384	1.4e-07	31.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PFD1`	Arabidopsis thaliana	BEL1-like homeodomain protein 11	54.579%	Swiss-Prot	moderate database homology
`Q9FWS9`	Arabidopsis thaliana	BEL1-like homeodomain protein 3	52.555%	Swiss-Prot	moderate database homology
`Q9FXG8`	Arabidopsis thaliana	BEL1-like homeodomain protein 10	51.825%	Swiss-Prot	moderate database homology
`Q9SIW1`	Arabidopsis thaliana	BEL1-like homeodomain protein 7	48.736%	Swiss-Prot	moderate database homology
`O65685`	Arabidopsis thaliana	BEL1-like homeodomain protein 6	44.179%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card