TkA07G408460 | RubberDandelionOmics

Gene overview

TkA07G408460

Reference: TK1151 Chr: Chr07 Coordinates: 102748691-102751912 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1610 bp · TkA07G408460|TK1151|cDNA

CAATAATCAGTTATGTTTACTGAAAAAGATAAAAATCGTACAAAAACATTGATCGTCGTATTGGACGGATCAAAAGTTTTGAGGGAGAAAACTGGTGTCGCGCCGCTAAGTTACGCCCTCCGGCAGGTGGTGCAGCCGGACGATGAGGTGGTTGTGCTCGTAATCTTCAACTCCGCCGATATGACACAGTCGCCGGTTATTTCCAGTTGCTGTATCGGAACTGATGGTCGGAATCATCAACCAAATGAAAGAGACAGAAA...

CDS

Download CDS FASTA

837 bp · TkA07G408460|TK1151|CDS

ATGACGGCACATGGATTAGATTTTCTTGAAGAACTAAGTTGGGAGGTGATATCGGAGATAACGGATCGATTCAAGAACATAATTAACGTATCTTCAAATGAGGCGTTTCAGATGTACAGCGGGTATCTTGAAGATCGATCGTGTGAAGTTTTCGTGAAAAGATTCGTTGGCACGGATTTTAATTACGTTCTTGAATCCGAAAAGAAGGCAGCTTTGACTATGTATCATAAGAACATTGTTCGATTGCTTGGTTTTCATCA...

Protein

Download Protein FASTA

279 aa · TkA07G408460|TK1151|PROTEIN

MTAHGLDFLEELSWEVISEITDRFKNIINVSSNEAFQMYSGYLEDRSCEVFVKRFVGTDFNYVLESEKKAALTMYHKNIVRLLGFHQNETAMALVFPYASRGSLMDRFLNGFWTREFPFNDKMNIAIGIAQGLRYMHEQCPRGPIVHGDLRACNILLGGNLEPQITGFCHAKQLQIEHSSDTSSSSCGHKHPSDPASLEMIKMDVLAFGILLLRLFCNRSAPRHDQNFLKWARPLLSERAYHILYDESEHDFHGLLVVTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G408460`
TK1151 ID	TkA07G408460
OH-1004 ID	LXL04_030501
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 45.888 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G408460

Location Chr07:102748691-102751912 (+)

Description Similar to RIPK: Serine/threonine-protein kinase RIPK

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05140`	Receptor-like cytosolic serine/threonine-protein kinase RBK2.	No verified direct reference in this release
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
`At1g31420`	Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1- aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).	Two leucine-rich repeat receptor kinases mediate signaling, linking cell wall biosynthesis and ACC synthase in Arabidopsis.2008 · DOI: 10.1105/tpc.108.063354

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q25AG2`	Does not seem to be involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`Os04g0202800`	Does not seem to be involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030501 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0007639 homeostasis of number of meristem cells Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

KEGG gene cross-reference

ath:AT1G07870

ath:AT2G05940

ath:AT3G01300

ath:AT3G28690

ath:AT5G45780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.465

Rank 1 · TkA07G408460 · TK1151

Cell membrane0.388

Rank 2 · TkA07G408460 · TK1151

Nucleus0.338

Rank 3 · TkA07G408460 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA07G408460 · TK1151

Mitochondrion0.039

Rank 5 · TkA07G408460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr44-278 aa

PF00069Pkinase64-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G408460	`PF07714`	PK_Tyr_Ser-Thr	44	278	6.8e-18	65.6
TkA07G408460	`PF00069`	Pkinase	64	223	2.1e-16	60.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXC8`	Arabidopsis thaliana	sp\|Q8RXC8\|RBK2_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK2	33.300%	Swiss-Prot	Medium
`Q9FGL5`	Arabidopsis thaliana	sp\|Q9FGL5\|CEPR1_ARATH Receptor protein-tyrosine kinase CEPR1	30.500%	Swiss-Prot	Medium
`C0LGF4`	Arabidopsis thaliana	sp\|C0LGF4\|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1	30.700%	Swiss-Prot	Medium
`Q25AG2`	Oryza sativa subsp. indica	sp\|Q25AG2\|LERK4_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK4	28.500%	Swiss-Prot	Low
`Q7FAZ0`	Oryza sativa subsp. japonica	sp\|Q7FAZ0\|LERK4_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK4	28.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card