LXL04_030501 | RubberDandelionOmics

Gene overview

LXL04_030501

Reference: OH-1004 Chr: Chr06 Coordinates: 117367527-117370639 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1827 bp · LXL04_030501|LXL04_030501|OH1004|cDNA

ATGTTTACTGAAAAAGATATAAATCGTACAAAAACATTGATCGTCGTATTGGACGGATCAAAAGTTTTGAGGGAGAAAACTGGTGTCGCGCCGCTAAGTTACGCCCTCCGGCAGGTGGTGCAGCCGGACGATGAGGTGGTTGTGCTCGTAATCTTCAACTCCGCCGATATGACACAGTCGCCGGTTATTTCCAGTTGCTGTATCGGAACTGATGGCCGGAATCATCAACCAAATGAAAGAGACAGAAACATTAGGATTCT...

CDS

Download CDS FASTA

1827 bp · LXL04_030501|LXL04_030501|OH1004|CDS

ATGTTTACTGAAAAAGATATAAATCGTACAAAAACATTGATCGTCGTATTGGACGGATCAAAAGTTTTGAGGGAGAAAACTGGTGTCGCGCCGCTAAGTTACGCCCTCCGGCAGGTGGTGCAGCCGGACGATGAGGTGGTTGTGCTCGTAATCTTCAACTCCGCCGATATGACACAGTCGCCGGTTATTTCCAGTTGCTGTATCGGAACTGATGGCCGGAATCATCAACCAAATGAAAGAGACAGAAACATTAGGATTCT...

Protein

Download Protein FASTA

608 aa · LXL04_030501|LXL04_030501|OH1004|PROTEIN

MFTEKDINRTKTLIVVLDGSKVLREKTGVAPLSYALRQVVQPDDEVVVLVIFNSADMTQSPVISSCCIGTDGRNHQPNERDRNIRILREEISQGTEGYMRIFRPFHRECKNMGVKFIAKIVVGPTLTSIILEEKNNTGATLVVIGRGFSMESVPCASRMKTCKFSSMSTEDEEVILYTFNGESSGFKSEDYATQKPSKYKKKSSFIDDEKPIYCILPNFDGIYQPSSSSSSISEPQQETDHFVESNIASSSSSLMTAHGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030501`
TK1151 ID	TkA07G408460
OH-1004 ID	LXL04_030501
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 45.888 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030501

Location Chr06:117367527-117370639 (+)

Description Similar to RIPK: Serine/threonine-protein kinase RIPK

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28690`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At2g05940`	Serine/threonine-protein kinase involved in disease resistance.	xopAC-triggered immunity against Xanthomonas depends on Arabidopsis receptor-like cytoplasmic kinase genes PBL2 and RIPK.2013 · DOI: 10.1371/journal.pone.0073469 Pseudomonas syringae Effector AvrPphB Suppresses AvrB-Induced Activation of RPM1 but Not AvrRpm1-Induced Activation.2015 · DOI: 10.1094/mpmi-08-14-0248-r
`At1g07870`	May be involved in plant defense signaling.	No verified direct reference in this release
`At3g01300`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At5g45780`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030501 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0007639 homeostasis of number of meristem cells Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

KEGG gene cross-reference

ath:AT1G07870

ath:AT2G05940

ath:AT3G01300

ath:AT3G28690

ath:AT5G45780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.437

Rank 1 · LXL04_030501 · OH-1004

Nucleus0.350

Rank 2 · LXL04_030501 · OH-1004

Cytoplasm0.337

Rank 3 · LXL04_030501 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_030501 · OH-1004

Golgi apparatus0.039

Rank 5 · LXL04_030501 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr299-537 aa

PF00069.32Pkinase319-477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030501	`PF07714.24`	PK_Tyr_Ser-Thr	299	537	9.5e-18	65.1
LXL04_030501	`PF00069.32`	Pkinase	319	477	9.1e-16	58.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J0D2`	Arabidopsis thaliana	Serine/threonine-protein kinase PBL36	30.973%	Swiss-Prot	weak database homology
`Q9ZUF4`	Arabidopsis thaliana	Serine/threonine-protein kinase RIPK	30.973%	Swiss-Prot	weak database homology
`Q9LQQ8`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL5	26.062%	Swiss-Prot	weak database homology
`Q9SRH7`	Arabidopsis thaliana	Serine/threonine-protein kinase PBL35	31.416%	Swiss-Prot	weak database homology
`C0LGU5`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 4	32.450%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card