TkA07G404790 | RubberDandelionOmics

Gene overview

TkA07G404790

Reference: TK1151 Chr: Chr07 Coordinates: 101768596-101769789 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1149 bp · TkA07G404790|TK1151|cDNA

ATGGCAACCAATCCTTCTTATTCCACAATCGATATCATTCGCAAACATCTTCTTGATGAGCAAGATGAAGTTTCCAAATTGCTCACTGCGAAGGAGAATCCTGGCAGTGATCAGACCGGTTCTAGCAACGAAAATGCTTCAGTACTGTGTATGCATAAGATCGGGGAAGAAGATTCACGTGATAATGAAGATCTAGTGATGAAGTCCAAGAATGCGAAGAAAAAGAGAAAGACGGCGGAAAATGGAGAAGACGACGTGGT...

CDS

Download CDS FASTA

1149 bp · TkA07G404790|TK1151|CDS

ATGGCAACCAATCCTTCTTATTCCACAATCGATATCATTCGCAAACATCTTCTTGATGAGCAAGATGAAGTTTCCAAATTGCTCACTGCGAAGGAGAATCCTGGCAGTGATCAGACCGGTTCTAGCAACGAAAATGCTTCAGTACTGTGTATGCATAAGATCGGGGAAGAAGATTCACGTGATAATGAAGATCTAGTGATGAAGTCCAAGAATGCGAAGAAAAAGAGAAAGACGGCGGAAAATGGAGAAGACGACGTGGT...

Protein

Download Protein FASTA

382 aa · TkA07G404790|TK1151|PROTEIN

MATNPSYSTIDIIRKHLLDEQDEVSKLLTAKENPGSDQTGSSNENASVLCMHKIGEEDSRDNEDLVMKSKNAKKKRKTAENGEDDVVEWTRYRGVRRRPWGKFTAEIRNPEKKKARLWLGTYNTPEEAAVAYDKAAFMFRGTRAKVNFPLLLREGDCKPVTSSSSSNSDNAKCNKNVAVDPTTNLVEPSIAANSTTVENVRNEKCFHRELPGSTVHSPTTTAVTEGASALDSLWNFQMNIFPPLSPTLSIGDYTIHSTET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G404790`
TK1151 ID	TkA07G404790
OH-1004 ID	LXL04_030457
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 99.250 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G404790

Location Chr07:101768596-101769789 (-)

Description Similar to ERF13: Ethylene-responsive transcription factor 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44840`	Acts as a transcriptional activator.	No verified direct reference in this release
`At4g17500`	Acts as a transcriptional activator.	No verified direct reference in this release
`At5g47220`	Acts as a transcriptional activator.	Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression.2000 · DOI: 10.1105/tpc.12.3.393 A role for the GCC-box in jasmonate-mediated activation of the PDF1.2 gene of Arabidopsis.2003 · DOI: 10.1104/pp.102.017814
`At1g28370`	Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030457 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009624 response to nematode Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G03800

ath:AT2G44840

ath:AT4G17500

ath:AT5G47220

nta:107825044

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA07G404790 · TK1151

Cytoplasm0.091

Rank 2 · TkA07G404790 · TK1151

Cell membrane0.031

Rank 3 · TkA07G404790 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA07G404790 · TK1151

Plastid0.015

Rank 5 · TkA07G404790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP290-141 aa

PF07207Lir1159-194 aa

PF07207Lir1264-316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G404790	`PF00847`	AP2	90	141	7.1e-14	52.6
TkA07G404790	`PF07207`	Lir1	159	194	0.085	13.9
TkA07G404790	`PF07207`	Lir1	264	316	0.085	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9K1`	Arabidopsis thaliana	sp\|Q8L9K1\|ERF99_ARATH Ethylene-responsive transcription factor 13	71.600%	Swiss-Prot	Low
`O80337`	Arabidopsis thaliana	sp\|O80337\|EF100_ARATH Ethylene-responsive transcription factor 1A	63.800%	Swiss-Prot	Low
`O80338`	Arabidopsis thaliana	sp\|O80338\|EF101_ARATH Ethylene-responsive transcription factor 2	58.400%	Swiss-Prot	Low
`Q9C5I3`	Arabidopsis thaliana	sp\|Q9C5I3\|ERF76_ARATH Ethylene-responsive transcription factor 11	59.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card