LXL04_030457 | RubberDandelionOmics

Gene overview

LXL04_030457

Reference: OH-1004 Chr: Chr06 Coordinates: 116489735-116490937 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1203 bp · LXL04_030457|LXL04_030457|OH1004|cDNA

ATGTCTTCCATGGCAACCAATCCTTCTTATTCCACAATCGATATCATTCGCAAACATCTTCTTGATGAGCAAGATGAAGTTTCCAAATTGCTCACTGCGAAGGAGAATCCTGGCAGTGATCAGACCGGTTCTAGCAACGAAAATGCTTCAGTACTGTGTATGCATAAGATCGGGGAAGAAGATTCACGTGATAATGAAGATCTAGTGATGAAGTCCAAGAATGCGAAGAAAAAGAGAAAGACGGCGGAAAATGGAGAAGA...

CDS

Download CDS FASTA

1203 bp · LXL04_030457|LXL04_030457|OH1004|CDS

ATGTCTTCCATGGCAACCAATCCTTCTTATTCCACAATCGATATCATTCGCAAACATCTTCTTGATGAGCAAGATGAAGTTTCCAAATTGCTCACTGCGAAGGAGAATCCTGGCAGTGATCAGACCGGTTCTAGCAACGAAAATGCTTCAGTACTGTGTATGCATAAGATCGGGGAAGAAGATTCACGTGATAATGAAGATCTAGTGATGAAGTCCAAGAATGCGAAGAAAAAGAGAAAGACGGCGGAAAATGGAGAAGA...

Protein

Download Protein FASTA

400 aa · LXL04_030457|LXL04_030457|OH1004|PROTEIN

MSSMATNPSYSTIDIIRKHLLDEQDEVSKLLTAKENPGSDQTGSSNENASVLCMHKIGEEDSRDNEDLVMKSKNAKKKRKTAENGEDDVVEWTRYRGVRRRPWGKFTAEIRNPEKKKARLWLGTYNTPEEAAVAYDKAAFMFRGTRAKVNFPLLLREGDCKPVTSSSSSNSDNAKCNKNVAVDPTTVCWNVEVRNDSSPSNNLVEPSIAANSTTVENVRNEKCFHRELPGSTVHSPTTTAVTEGASALDSLWNFQMNIFP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030457`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030457

Location Chr06:116489735-116490937 (-)

Description Similar to ERF13: Ethylene-responsive transcription factor 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44840`	Acts as a transcriptional activator.	No verified direct reference in this release
`At1g03800`	Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.	No verified direct reference in this release
`At4g17500`	Acts as a transcriptional activator.	No verified direct reference in this release
`At5g47220`	Acts as a transcriptional activator.	Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression.2000 · DOI: 10.1105/tpc.12.3.393 A role for the GCC-box in jasmonate-mediated activation of the PDF1.2 gene of Arabidopsis.2003 · DOI: 10.1104/pp.102.017814

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030457 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009624 response to nematode Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G03800

ath:AT2G44840

ath:AT4G17500

ath:AT5G47220

nta:107825044

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · LXL04_030457 · OH-1004

Cytoplasm0.092

Rank 2 · LXL04_030457 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_030457 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_030457 · OH-1004

Plastid0.014

Rank 5 · LXL04_030457 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP293-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030457	`PF00847.27`	AP2	93	144	7.3e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9K1`	Arabidopsis thaliana	Ethylene-responsive transcription factor 13	70.588%	Swiss-Prot	weak database homology
`Q9ZWA2`	Arabidopsis thaliana	Ethylene-responsive transcription factor 10	38.857%	Swiss-Prot	weak database homology
`O80337`	Arabidopsis thaliana	Ethylene-responsive transcription factor 1A	63.768%	Swiss-Prot	weak database homology
`O80338`	Arabidopsis thaliana	Ethylene-responsive transcription factor 2	58.974%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card