TkA07G392450 | RubberDandelionOmics

Gene overview

TkA07G392450

Reference: TK1151 Chr: Chr07 Coordinates: 98526513-98531560 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2844 bp · TkA07G392450|TK1151|cDNA

CTATTAATAACCCAAGGCCCAATCCATTCAACGTAAAAGCAAAAGCAACATTGATTTGATTTTTGAAATCAAACAGAAAACTCAAAACTTTTATCTCTGCACATCCCGCCTATACACCTAACACTCCTCGCCTCCATCATCAACAAGTTTCAGTTTCAGATCCAGCTCAATCCTTGAAGTTTTGTGTACAGATATGGAGAAAATATGTGTCGCAGTGAGAGTGAGGCCACCGGTGAAATCAGAAGAGGATTTTAGTTCCA...

CDS

Download CDS FASTA

2367 bp · TkA07G392450|TK1151|CDS

ATGGAGAAAATATGTGTCGCAGTGAGAGTGAGGCCACCGGTGAAATCAGAAGAGGATTTTAGTTCCAATGGTACTCACTGGAAGGTAGACGACAACCGTATTTCTCTGCACAGGTCTCTATCCGGCACACCTCTTCCGCCTGCTCTTTCTTACACTTTCGATCATGTTTTCGACCAAAAGTGCTCCAATTCTAGCGTTTATGACCTCCTCACCAAGGACATTATCCATGCTGTCGTTGACGGATTCAATGGTACTGCGTT...

Protein

Download Protein FASTA

788 aa · TkA07G392450|TK1151|PROTEIN

MEKICVAVRVRPPVKSEEDFSSNGTHWKVDDNRISLHRSLSGTPLPPALSYTFDHVFDQKCSNSSVYDLLTKDIIHAVVDGFNGTAFAYGQTSSGKTFTMNGSENDPGIIHRAVKDIFAKIDMSTDREFLIRVSYMEIYNEEINDLFAVENQKLQIHESLERGIFVAGLREEIVNSSEQVLKLIEMGEVNRHFGETNMNVRSSRSHTIFRMVIESKGKDSSTSLDDAIRVSVLNLVDLAGSERIAKTGAGGVRLKEGKHI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G392450`
TK1151 ID	TkA07G392450
OH-1004 ID	LXL04_029375
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.400
Protein coverage (%)	TK1151 50.127 / OH-1004 29.385 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G392450

Location Chr07:98526513-98531560 (-)

Description Similar to KIN7O: Kinesin-like protein KIN-7O

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g59540`	Kinesin-like protein KIN-7N.	No verified direct reference in this release
`UniProt: F4J2K4`	Kinesin-like protein KIN-7O.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0552600`	Kinesin-like protein KIN-7L.	No verified direct reference in this release
`Os09g0421200`	Kinesin-like protein KIN-7I.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029375 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0008608 attachment of spindle microtubules to kinetochore Biological Process

GO:0033044 regulation of chromosome organization Biological Process

GO:0042327 positive regulation of phosphorylation Biological Process

GO:0140694 membraneless organelle assembly Biological Process

GO:1901987 regulation of cell cycle phase transition Biological Process

GO:0000776 kinetochore Cellular Component

GO:0000779 condensed chromosome, centromeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

KEGG gene cross-reference

ath:AT1G59540

ath:AT3G10180

dosa:Os09g0421200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.628

Rank 1 · TkA07G392450 · TK1151

Nucleus0.374

Rank 2 · TkA07G392450 · TK1151

Cell membrane0.064

Rank 3 · TkA07G392450 · TK1151

Golgi apparatus0.048

Rank 4 · TkA07G392450 · TK1151

Mitochondrion0.046

Rank 5 · TkA07G392450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796Microtub_bd6-146 aa

PF00225Kinesin9-334 aa

PF03245Phage_lysis168-180 aa

PF15278Sec3_C_2213-236 aa

PF07109Mg-por_mtran_C284-358 aa

PF15278Sec3_C_2346-370 aa

PF16796Microtub_bd519-598 aa

PF15278Sec3_C_2536-588 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G392450	`PF16796`	Microtub_bd	6	146	2e-20	74.0
TkA07G392450	`PF00225`	Kinesin	9	334	2.6e-112	375.7
TkA07G392450	`PF03245`	Phage_lysis	168	180	4.4	8.2
TkA07G392450	`PF15278`	Sec3_C_2	213	236	0.058	14.5
TkA07G392450	`PF07109`	Mg-por_mtran_C	284	358	0.21	12.7
TkA07G392450	`PF15278`	Sec3_C_2	346	370	0.058	14.5
TkA07G392450	`PF16796`	Microtub_bd	519	598	2e-20	74.0
TkA07G392450	`PF15278`	Sec3_C_2	536	588	0.058	14.5
TkA07G392450	`PF03245`	Phage_lysis	544	588	4.4	8.2
TkA07G392450	`PF03245`	Phage_lysis	682	706	4.4	8.2
TkA07G392450	`PF15278`	Sec3_C_2	726	775	0.058	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7P3`	Arabidopsis thaliana	sp\|Q9S7P3\|KN7N_ARATH Kinesin-like protein KIN-7N	53.700%	Swiss-Prot	High
`F4J2K4`	Arabidopsis thaliana	sp\|F4J2K4\|KN7O_ARATH Kinesin-like protein KIN-7O	61.700%	Swiss-Prot	Medium
`Q2R2P7`	Oryza sativa subsp. japonica	sp\|Q2R2P7\|KN7L_ORYSJ Kinesin-like protein KIN-7L	65.300%	Swiss-Prot	Medium
`B9G3M6`	Oryza sativa subsp. japonica	sp\|B9G3M6\|KN7I_ORYSJ Kinesin-like protein KIN-7I	63.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card