TkA07G382530 | RubberDandelionOmics

Gene overview

TkA07G382530

Reference: TK1151 Chr: Chr07 Coordinates: 95890237-95890849 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

318 bp · TkA07G382530|TK1151|CDS

ATGATGTCACATGTTGTCATTGGAATCAGTCACCAAACAAATATTCGGATTTTAGTTTTAAATAATACCACCATAACTTGGTCTCACATTGAAGTGCTTAAGGATTCACTCCAAGCCATCCAAGAACTGCATCTAATGGGAAATAAGTTGAAGGAGATAACACCTACATCATCGAATATTGTGAAAGGATTTGATAATTTGCGGATTCTTAACTTGGAAGATAACTATATAGCTGATTGGACTGAAATCTTTAAGCTTTC...

Protein

Download Protein FASTA

106 aa · TkA07G382530|TK1151|PROTEIN

MMSHVVIGISHQTNIRILVLNNTTITWSHIEVLKDSLQAIQELHLMGNKLKEITPTSSNIVKGFDNLRILNLEDNYIADWTEIFKLSQLKCLEQLHLNKNNIEHIW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G382530`
TK1151 ID	TkA07G382530
OH-1004 ID	LXL04_003882
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.300
Protein coverage (%)	TK1151 100.000 / OH-1004 31.928 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G382530

Location Chr07:95890237-95890849 (+)

Description Similar to TFCE: Tubulin-folding cofactor E

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71440`	Essential tubulin-folding protein involved in the tubulin folding pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003882 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0007021 tubulin complex assembly Biological Process

GO:0007023 post-chaperonin tubulin folding pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043014 alpha-tubulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G71440

hsa:219899

mmu:272589

rno:315591

xla:495403

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · TkA07G382530 · TK1151

Nucleus0.440

Rank 2 · TkA07G382530 · TK1151

Mitochondrion0.073

Rank 3 · TkA07G382530 · TK1151

Cell membrane0.046

Rank 4 · TkA07G382530 · TK1151

Endoplasmic reticulum0.029

Rank 5 · TkA07G382530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01611Filo_glycop5-51 aa

PF14580LRR_911-75 aa

PF13516LRR_611-26 aa

PF12799LRR_413-54 aa

PF29594LRR_SKP213-98 aa

PF24048LRR_NXF1-514-102 aa

PF13855LRR_814-77 aa

PF00560LRR_114-33 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G382530	`PF01611`	Filo_glycop	5	51	0.35	10.4
TkA07G382530	`PF14580`	LRR_9	11	75	0.031	14.5
TkA07G382530	`PF13516`	LRR_6	11	26	0.59	11.0
TkA07G382530	`PF12799`	LRR_4	13	54	1.2e-10	42.0
TkA07G382530	`PF29594`	LRR_SKP2	13	98	0.053	13.5
TkA07G382530	`PF24048`	LRR_NXF1-5	14	102	2.4e-06	28.0
TkA07G382530	`PF13855`	LRR_8	14	77	1.2e-05	25.7
TkA07G382530	`PF00560`	LRR_1	14	33	0.00014	22.0
TkA07G382530	`PF23598`	LRR_14	15	97	0.12	11.9
TkA07G382530	`PF21788`	TNP-like_GBD	16	52	0.012	16.8
TkA07G382530	`PF12799`	LRR_4	40	82	1.2e-10	42.0
TkA07G382530	`PF00560`	LRR_1	40	56	0.00014	22.0
TkA07G382530	`PF13516`	LRR_6	40	50	0.59	11.0
TkA07G382530	`PF13855`	LRR_8	41	102	1.2e-05	25.7
TkA07G382530	`PF14580`	LRR_9	41	105	0.031	14.5
TkA07G382530	`PF21788`	TNP-like_GBD	64	105	0.012	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GRL7`	Arabidopsis thaliana	sp\|Q8GRL7\|TBCE_ARATH Tubulin-folding cofactor E	57.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card