LXL04_003882 | RubberDandelionOmics

Gene overview

LXL04_003882

Reference: OH-1004 Chr: Chr01 Coordinates: 111737010-111739473 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · LXL04_003882|LXL04_003882|OH1004|cDNA

ATGGTGCTATTGGGTAAAGATAAGATTGAAGACATATTGGGTCGATTCGAGGAGTTGCCTGGTGCATCGCTTTCGTATCAAGGGGTCAGCTCATCTGAAGACCCTCTTGAGATTAGTAAGACTCTACCAATAATGGACCTTGTATCAGTTAATGGAGAAACCTGTAAAATGGTTGTTGGTAGCATCTGCAGTGGGCTTCCAGCTCTTTCAAGACTTAATCTGACAAACAATATGATGTCACATGCTGTCATTGGAATCAG...

CDS

Download CDS FASTA

999 bp · LXL04_003882|LXL04_003882|OH1004|CDS

ATGGTGCTATTGGGTAAAGATAAGATTGAAGACATATTGGGTCGATTCGAGGAGTTGCCTGGTGCATCGCTTTCGTATCAAGGGGTCAGCTCATCTGAAGACCCTCTTGAGATTAGTAAGACTCTACCAATAATGGACCTTGTATCAGTTAATGGAGAAACCTGTAAAATGGTTGTTGGTAGCATCTGCAGTGGGCTTCCAGCTCTTTCAAGACTTAATCTGACAAACAATATGATGTCACATGCTGTCATTGGAATCAG...

Protein

Download Protein FASTA

332 aa · LXL04_003882|LXL04_003882|OH1004|PROTEIN

MVLLGKDKIEDILGRFEELPGASLSYQGVSSSEDPLEISKTLPIMDLVSVNGETCKMVVGSICSGLPALSRLNLTNNMMSHAVIGISHLTNIRILVLNNTTITWSQIEVLKDSLQAIQELHLMGNKLKEITPTSSNIVKGFDTLRILNLEDNYIADWTEILKLSQLKCLEQLHLNKNNIEHIWYPTTNDENSYKPFQNLRCLLIGGNKIEDVASMDALNSYPGLVDIRCSDNPATDPIKGGISRFVLIARLAKVTILNGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003882`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003882

Location Chr01:111737010-111739473 (-)

Description Similar to TFCE: Tubulin-folding cofactor E

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71440`	Essential tubulin-folding protein involved in the tubulin folding pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003882 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0007021 tubulin complex assembly Biological Process

GO:0007023 post-chaperonin tubulin folding pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043014 alpha-tubulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G71440

hsa:219899

mmu:272589

rno:315591

xla:495403

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · LXL04_003882 · OH-1004

Nucleus0.437

Rank 2 · LXL04_003882 · OH-1004

Mitochondrion0.072

Rank 3 · LXL04_003882 · OH-1004

Cell membrane0.050

Rank 4 · LXL04_003882 · OH-1004

Endoplasmic reticulum0.031

Rank 5 · LXL04_003882 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14580.13LRR_9118-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003882	`PF14580.13`	LRR_9	118	271	2.3e-08	34.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GRL7`	Arabidopsis thaliana	Tubulin-folding cofactor E	54.819%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card