TkA07G374850 | RubberDandelionOmics

Gene overview

TkA07G374850

Reference: TK1151 Chr: Chr07 Coordinates: 94056264-94058629 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1479 bp · TkA07G374850|TK1151|cDNA

CGAAAGTTGTTCATATAAAGTTTAGGGGGACGATCTGAGAACTTAAGATAATGGGTGTCGATTATCATAAAAACAGTAAACACTGTGTAGTCATCATCTTTCTCTTTGGACTCCAGAAAACCCAAAAGAAAGGAAGAAAACCATCGATTTTTATGCATTTATCAAACTAAATTATTTACAAGTTCAAAATTTTTGCCTTCCCGATCTCTGTTCAAAAGCTAAGAATTTTATCAGAAGTTTGTTCATATGCATATTAATTG...

CDS

Download CDS FASTA

894 bp · TkA07G374850|TK1151|CDS

ATGTATATCTCGAGATCAACCAAAACTATGAGTCCATCGAGGGTTTTGCGAACTGGGTTTATTCTATTGGCGATTCTTGCTCGGCTAACGTACGCCGATGAGCTCTCTAGGGTTTCCAATCCTGTCTGCCCCACAAAGTCGATTACTTCTGCGATCCTTGGAAATGGAGCTTCCATTTGTCCCTGGAGTGGAATTAGTTATTCCCTCGGTGTGATTGAGGGAGATGACACATCAATTCAAAAGGCTTTGAGTAGGATTAA...

Protein

Download Protein FASTA

297 aa · TkA07G374850|TK1151|PROTEIN

MYISRSTKTMSPSRVLRTGFILLAILARLTYADELSRVSNPVCPTKSITSAILGNGASICPWSGISYSLGVIEGDDTSIQKALSRINTNTHDYISVLFYASWCPFSTIFKPSLSIMSSFYPSIPHFAIEESAVKPSLLSKYGVNGFPTLFILNSTMRVRYHGSRTLSSLVNFYSDVTGIEAESMDKTSLDKMDTFVQEKDDNISEPPEFCPFSWAKSPENLFRQETYLFLATVFVVFRSLYLTYPLIVTSARYARRTRLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G374850`
TK1151 ID	TkA07G374850
OH-1004 ID	LXL04_030116
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G374850

Location Chr07:94056264-94058629 (+)

Description Similar to APRL4: 5'-adenylylsulfate reductase-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34780`	5'-adenylylsulfate reductase-like 4.	No verified direct reference in this release
`At4g08930`	5'-adenylylsulfate reductase-like 6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0754900`	5'-adenylylsulfate reductase-like 3.	No verified direct reference in this release
`Os08g0412401`	5'-adenylylsulfate reductase-like 4.	No verified direct reference in this release
`Os06g0220800`	5'-adenylylsulfate reductase-like 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030116 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G34780

ath:AT4G08930

dosa:Os02g0754900

dosa:Os06g0220800

dosa:Os08g0412401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.438

Rank 1 · TkA07G374850 · TK1151

Golgi apparatus0.232

Rank 2 · TkA07G374850 · TK1151

Nucleus0.161

Rank 3 · TkA07G374850 · TK1151

Cytoplasm0.119

Rank 4 · TkA07G374850 · TK1151

Lysosome / Vacuole0.113

Rank 5 · TkA07G374850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13098Thioredoxin_281-154 aa

PF00085Thioredoxin90-172 aa

PF13905Thioredoxin_893-118 aa

PF13905Thioredoxin_8135-158 aa

PF27914APRL7_C219-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G374850	`PF13098`	Thioredoxin_2	81	154	0.03	15.3
TkA07G374850	`PF00085`	Thioredoxin	90	172	3.2e-07	31.0
TkA07G374850	`PF13905`	Thioredoxin_8	93	118	0.004	18.2
TkA07G374850	`PF13905`	Thioredoxin_8	135	158	0.004	18.2
TkA07G374850	`PF27914`	APRL7_C	219	281	2.2e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA00`	Arabidopsis thaliana	sp\|Q9SA00\|APRL4_ARATH 5'-adenylylsulfate reductase-like 4	51.300%	Swiss-Prot	High
`Q9ZPE9`	Arabidopsis thaliana	sp\|Q9ZPE9\|APRL6_ARATH 5'-adenylylsulfate reductase-like 6	45.100%	Swiss-Prot	Medium
`Q84P95`	Oryza sativa subsp. japonica	sp\|Q84P95\|APRL3_ORYSJ 5'-adenylylsulfate reductase-like 3	44.300%	Swiss-Prot	Medium
`Q5DJV7`	Oryza sativa subsp. japonica	sp\|Q5DJV7\|APRL4_ORYSJ 5'-adenylylsulfate reductase-like 4	43.400%	Swiss-Prot	Medium
`Q67VZ8`	Oryza sativa subsp. japonica	sp\|Q67VZ8\|APRL2_ORYSJ 5'-adenylylsulfate reductase-like 2	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card