TkA07G373940 | RubberDandelionOmics

Gene overview

TkA07G373940

Reference: TK1151 Chr: Chr07 Coordinates: 93804167-93805461 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

887 bp · TkA07G373940|TK1151|cDNA

TGATTATAAGCGATGAATGGGGGATAAAACTGGTTAAGAGATTTCGTCAACGAAAAATCCTCATCTAGGCGAGTTTGTTGCGAGATTTCGATCATATATAAAGAGGTAACAGCAAGCAAGGTTGCTGTGACCGCAGAATTCACCAGATAAACCTCTACCCAAGGATGTTTGAATTTTGTAAAAAAAACGTGCTTACACTTAAATCCTTCGTTAGGGATCATGCGGGTGGAAATGAGAAGATCAAAGAGTTGGTTCCAGGG...

CDS

Download CDS FASTA

627 bp · TkA07G373940|TK1151|CDS

ATGTTTGAATTTTGTAAAAAAAACGTGCTTACACTTAAATCCTTCGTTAGGGATCATGCGGGTGGAAATGAGAAGATCAAAGAGTTGGTTCCAGGGATTAAAGTCTATGGAGGTAATGCCGATAATGTAAAAGGGTGTACTAATAAAGTGGAAAATGGCGATAAGTTGTCACTTGGGGATTCTATCAATATACTCTCTCTTCACACACCATGCCACACCAAGGGACACATAAGTTACTATGTCACTGGTAAAGAAGAAGA...

Protein

Download Protein FASTA

208 aa · TkA07G373940|TK1151|PROTEIN

MFEFCKKNVLTLKSFVRDHAGGNEKIKELVPGIKVYGGNADNVKGCTNKVENGDKLSLGDSINILSLHTPCHTKGHISYYVTGKEEEDPAVFTGDTLFVAGCGKFFEGTAEQMHESLCVTLASLPKPTRVYCGHEYTVKNLQFAQTVEPDNEKISEKLSWAQKQRQSGLPTIPSTIEEELETNPSCDLIYLKFRRGLDVSLLLKQCVR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G373940`
TK1151 ID	TkA07G373940
OH-1004 ID	LXL04_035461
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.500
Protein coverage (%)	TK1151 84.615 / OH-1004 67.557 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G373940

Location Chr07:93804167-93805461 (+)

Description Similar to GLX2-2: Hydroxyacylglutathione hydrolase cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10850`	Thiolesterase that catalyzes the hydrolysis of S-D-lactoyl- glutathione to form glutathione and D-lactic acid.	The metal ion requirements of Arabidopsis thaliana Glx2-2 for catalytic activity.2010 · DOI: 10.1007/s00775-009-0593-6

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035461 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0019243 methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione Biological Process

GO:0019853 L-ascorbic acid biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004416 hydroxyacylglutathione hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G10850

bta:509274

dre:336977

gga:416537

xtr:100216043

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.626

Rank 1 · TkA07G373940 · TK1151

Nucleus0.367

Rank 2 · TkA07G373940 · TK1151

Mitochondrion0.153

Rank 3 · TkA07G373940 · TK1151

Cell membrane0.071

Rank 4 · TkA07G373940 · TK1151

Endoplasmic reticulum0.068

Rank 5 · TkA07G373940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00753Lactamase_B66-134 aa

PF16123HAGH_C135-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G373940	`PF00753`	Lactamase_B	66	134	0.00037	21.2
TkA07G373940	`PF16123`	HAGH_C	135	184	7e-18	65.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O24496`	Arabidopsis thaliana	sp\|O24496\|GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic	81.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card