TkA07G372500 | RubberDandelionOmics

Gene overview

TkA07G372500

Reference: TK1151 Chr: Chr07 Coordinates: 93427753-93431224 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3381 bp · TkA07G372500|TK1151|cDNA

ATGTTCGGCGCTCCAAAATTCTTCAAGTTCTCGAAGAAACTAACTACATTCAGGCACTTCTCGCACATGGGGGTTTGCAGAAATCCAAAAAGGTCACTGAAAAATGGTTATCAAACCAAAAACCAAAACAACTCCGCTAAATTAGGTTTGGAACTGGAGAACAGCATCTATGCAATTCTCACAATCAGCAGATGGGAGTCTCTAAATCAAATGAACTATAAACTAGTTTCCCTCAGACCAGTTCATGGAACCCTAGCTTT...

CDS

Download CDS FASTA

3381 bp · TkA07G372500|TK1151|CDS

ATGTTCGGCGCTCCAAAATTCTTCAAGTTCTCGAAGAAACTAACTACATTCAGGCACTTCTCGCACATGGGGGTTTGCAGAAATCCAAAAAGGTCACTGAAAAATGGTTATCAAACCAAAAACCAAAACAACTCCGCTAAATTAGGTTTGGAACTGGAGAACAGCATCTATGCAATTCTCACAATCAGCAGATGGGAGTCTCTAAATCAAATGAACTATAAACTAGTTTCCCTCAGACCAGTTCATGGAACCCTAGCTTT...

Protein

Download Protein FASTA

1126 aa · TkA07G372500|TK1151|PROTEIN

MFGAPKFFKFSKKLTTFRHFSHMGVCRNPKRSLKNGYQTKNQNNSAKLGLELENSIYAILTISRWESLNQMNYKLVSLRPVHGTLALKFLNWVIKQPAFQELKNLTYVYCITVHILIKARMYASAKSILTQLSDMGIDPNSIFSVLMDTYPLCKSNPAVFDLLIRVYLQESLIKDALVIFHLMGVRGFTPSIYTCNKILGSMRKDNEASWSFFKDMLSKNICPNVATFNILLNVLCFNGKIKKAEHLVFKMEESGYVPNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G372500`
TK1151 ID	TkA07G372500
OH-1004 ID	LXL04_030038
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 98.769 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G372500

Location Chr07:93427753-93431224 (-)

Description Similar to At5g55840: Pentatricopeptide repeat-containing protein At5g55840

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55840`	Pentatricopeptide repeat-containing protein At5g55840.	No verified direct reference in this release
`At1g19290`	Putative pentatricopeptide repeat-containing protein At1g19290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030038 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G39710

ath:AT5G55840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.835

Rank 1 · TkA07G372500 · TK1151

Plastid0.074

Rank 2 · TkA07G372500 · TK1151

Nucleus0.049

Rank 3 · TkA07G372500 · TK1151

Cytoplasm0.026

Rank 4 · TkA07G372500 · TK1151

Cell membrane0.010

Rank 5 · TkA07G372500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25245TPR_At1g6898042-134 aa

PF28737VPS18_solenoid_2nd85-135 aa

PF24760TPR_IF140_C90-132 aa

PF10037MRP-S2799-201 aa

PF01535PPR109-137 aa

PF13041PPR_2113-142 aa

PF13812PPR_3113-150 aa

PF23276TPR_24159-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G372500	`PF25245`	TPR_At1g68980	42	134	0.064	14.0
TkA07G372500	`PF28737`	VPS18_solenoid_2nd	85	135	0.0036	17.9
TkA07G372500	`PF24760`	TPR_IF140_C	90	132	0.001	20.2
TkA07G372500	`PF10037`	MRP-S27	99	201	4.6e-13	49.6
TkA07G372500	`PF01535`	PPR	109	137	1e-123	396.0
TkA07G372500	`PF13041`	PPR_2	113	142	6.8e-204	660.7
TkA07G372500	`PF13812`	PPR_3	113	150	5.7e-83	273.7
TkA07G372500	`PF23276`	TPR_24	159	245	1.2e-61	207.2
TkA07G372500	`PF13041`	PPR_2	160	200	6.8e-204	660.7
TkA07G372500	`PF01535`	PPR	160	188	1e-123	396.0
TkA07G372500	`PF13812`	PPR_3	162	201	5.7e-83	273.7
TkA07G372500	`PF13812`	PPR_3	179	235	5.7e-83	273.7
TkA07G372500	`PF28737`	VPS18_solenoid_2nd	190	263	0.0036	17.9
TkA07G372500	`PF17177`	PPR_long	202	340	8.2e-61	205.8
TkA07G372500	`PF13041`	PPR_2	204	236	6.8e-204	660.7
TkA07G372500	`PF25245`	TPR_At1g68980	204	253	0.064	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVQ5`	Arabidopsis thaliana	sp\|Q9LVQ5\|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840	55.900%	Swiss-Prot	Low
`Q9LN69`	Arabidopsis thaliana	sp\|Q9LN69\|PPR50_ARATH Putative pentatricopeptide repeat-containing protein At1g19290	29.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card