TkA07G371640 | RubberDandelionOmics

Gene overview

TkA07G371640

Reference: TK1151 Chr: Chr07 Coordinates: 93208956-93211736 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2714 bp · TkA07G371640|TK1151|cDNA

GATAACGTTTCGGTATTTTTCAGTTTTTTGATTCTCTCTTTATACATCTCTCTCCCGCCACTAGTCTCCTCCCTCTCTCCCGACGGTCAAACGCTACTCTCTCTCCTCCCCTCCGCCGCTTCTCTCTCTAAAACCTCCTCCACCGTGCTCTCTTCGTGGAACTCATCTTCTCTAACACCGTGTTCATGGCAGGGTGTTACTTGTTCACCGCAAAACAGAGTAATATCTCTCTCTATTCCGAACACATTCCTTAATCTCTC...

CDS

Download CDS FASTA

2535 bp · TkA07G371640|TK1151|CDS

GATAACGTTTCGGTATTTTTCAGTTTTTTGATTCTCTCTTTATACATCTCTCTCCCGCCACTAGTCTCCTCCCTCTCTCCCGACGGTCAAACGCTACTCTCTCTCCTCCCCTCCGCCGCTTCTCTCTCTAAAACCTCCTCCACCGTGCTCTCTTCGTGGAACTCATCTTCTCTAACACCGTGTTCATGGCAGGGTGTTACTTGTTCACCGCAAAACAGAGTAATATCTCTCTCTATTCCGAACACATTCCTTAATCTCTC...

Protein

Download Protein FASTA

844 aa · TkA07G371640|TK1151|PROTEIN

DNVSVFFSFLILSLYISLPPLVSSLSPDGQTLLSLLPSAASLSKTSSTVLSSWNSSSLTPCSWQGVTCSPQNRVISLSIPNTFLNLSSLPPQLSSLSSLQLLNLSSTNISGQIPPSFGSFPHLRLLDLSSNSIIGHIPPELGQLASLQFLYLDSNQLSGTIPPQLSNLSSLQYFCIQDNLINSTIPPQLGSLVALQEFRIGGNPYLTGEIPPELGFLSNLTTFGVAATGLSGVIPTTFKNMISLQTLAIYDTEISGSIPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G371640`
TK1151 ID	TkA07G371640
OH-1004 ID	LXL04_030029
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 78.366 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G371640

Location Chr07:93208956-93211736 (-)

Description Similar to At1g34110: Probable LRR receptor-like serine/threonine-protein kinase At1g34110

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34110`	Together with RGI1, RGI2, RGI3 and RGI4, acts as a receptor of RGF1, a peptide hormone that maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At3g24240`	Together with RGI2, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At5g61480`	Acts with CLE41p and CLE44p peptides as a ligand-receptor pair in a signal transduction pathway involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	No verified direct reference in this release
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030029 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009266 response to temperature stimulus Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010449 root meristem growth Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0001653 peptide receptor activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G34110

ath:AT3G24240

ath:AT4G26540

ath:AT5G48940

ath:AT5G56040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.812

Rank 1 · TkA07G371640 · TK1151

Endoplasmic reticulum0.095

Rank 2 · TkA07G371640 · TK1151

Cytoplasm0.062

Rank 3 · TkA07G371640 · TK1151

Nucleus0.042

Rank 4 · TkA07G371640 · TK1151

Lysosome / Vacuole0.037

Rank 5 · TkA07G371640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_226-69 aa

PF29594LRR_SKP271-132 aa

PF25019LRR_R13L1-DRL2175-105 aa

PF00560LRR_177-95 aa

PF20209DUF657080-98 aa

PF23598LRR_1481-152 aa

PF13855LRR_885-133 aa

PF12799LRR_485-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G371640	`PF08263`	LRRNT_2	26	69	4.8e-09	37.1
TkA07G371640	`PF29594`	LRR_SKP2	71	132	0.21	11.5
TkA07G371640	`PF25019`	LRR_R13L1-DRL21	75	105	0.028	15.0
TkA07G371640	`PF00560`	LRR_1	77	95	6.5e-66	204.6
TkA07G371640	`PF20209`	DUF6570	80	98	3.7	8.7
TkA07G371640	`PF23598`	LRR_14	81	152	1.8e-47	162.5
TkA07G371640	`PF13855`	LRR_8	85	133	2.9e-51	171.8
TkA07G371640	`PF12799`	LRR_4	85	114	2.7e-45	152.0
TkA07G371640	`PF24758`	LRR_At5g56370	86	133	1.2e-11	45.4
TkA07G371640	`PF23598`	LRR_14	88	223	1.8e-47	162.5
TkA07G371640	`PF25013`	LRR_Zer-1	93	112	0.0024	18.8
TkA07G371640	`PF25019`	LRR_R13L1-DRL21	94	153	0.028	15.0
TkA07G371640	`PF24048`	LRR_NXF1-5	96	172	0.0087	16.4
TkA07G371640	`PF29870`	YDR417C	96	114	1.2	10.0
TkA07G371640	`PF13516`	LRR_6	97	111	1.4e-08	34.8
TkA07G371640	`PF00560`	LRR_1	98	119	6.5e-66	204.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGF5`	Arabidopsis thaliana	sp\|C0LGF5\|RGI5_ARATH LRR receptor-like serine/threonine-protein kinase RGI5	58.200%	Swiss-Prot	Low
`C0LGV1`	Arabidopsis thaliana	sp\|C0LGV1\|RGI2_ARATH LRR receptor-like serine/threonine-protein kinase RGI2	40.200%	Swiss-Prot	Low
`Q9LHP4`	Arabidopsis thaliana	sp\|Q9LHP4\|RGI1_ARATH LRR receptor-like serine/threonine-protein kinase RGI1	36.700%	Swiss-Prot	Low
`Q9FII5`	Arabidopsis thaliana	sp\|Q9FII5\|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR	36.400%	Swiss-Prot	Low
`Q9M0G7`	Arabidopsis thaliana	sp\|Q9M0G7\|MIK1_ARATH MDIS1-interacting receptor like kinase 1	36.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card