LXL04_030029 | RubberDandelionOmics

Gene overview

LXL04_030029

Reference: OH-1004 Chr: Chr06 Coordinates: 106050362-106053852 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3234 bp · LXL04_030029|LXL04_030029|OH1004|cDNA

ATGGATAACGTTTCGGTATTTTTCAGTTTTTTGATTCTCTCTTTATACATCTCTCTCCCGCCACTAGTCTCCTCCCTCTCTCCCGACGGTCAAACGCTACTCTCTCTCCTCCCCTCCGCCGCTTCTCTCTCTAAAACCTCCTCCACCGTGCTCTCTTCGTGGAACTCATCTTCTCTAACACCGTGTTCATGGCAGGGTGTTACTTGTTCACCGCAAAACAGAGTAATATCTCTCTCTATTCCGAACACATTCCTTAATCT...

CDS

Download CDS FASTA

3234 bp · LXL04_030029|LXL04_030029|OH1004|CDS

ATGGATAACGTTTCGGTATTTTTCAGTTTTTTGATTCTCTCTTTATACATCTCTCTCCCGCCACTAGTCTCCTCCCTCTCTCCCGACGGTCAAACGCTACTCTCTCTCCTCCCCTCCGCCGCTTCTCTCTCTAAAACCTCCTCCACCGTGCTCTCTTCGTGGAACTCATCTTCTCTAACACCGTGTTCATGGCAGGGTGTTACTTGTTCACCGCAAAACAGAGTAATATCTCTCTCTATTCCGAACACATTCCTTAATCT...

Protein

Download Protein FASTA

1077 aa · LXL04_030029|LXL04_030029|OH1004|PROTEIN

MDNVSVFFSFLILSLYISLPPLVSSLSPDGQTLLSLLPSAASLSKTSSTVLSSWNSSSLTPCSWQGVTCSPQNRVISLSIPNTFLNLSSLPPQLSSLSSLQLLNLSSTNISGQIPPSFGSFPHLRLLDLSSNSIFGHIPPELGQLTSLQFLYLDSNQLSGTIPPQLSNLSSLQYFCIQDNLINSTIPPQLGSLVALQEFRIGGNPYLTGEIPPELGFLSNLTTFGVAATGLSGVIPTTFKNMISLQTLAIYDTEISGSIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030029`
TK1151 ID	TkA07G371640
OH-1004 ID	LXL04_030029
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 78.366 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030029

Location Chr06:106050362-106053852 (-)

Description Similar to At1g34110: Probable LRR receptor-like serine/threonine-protein kinase At1g34110

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34110`	Together with RGI1, RGI2, RGI3 and RGI4, acts as a receptor of RGF1, a peptide hormone that maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At3g24240`	Together with RGI2, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At5g56040`	Receptor with a serine/threonine-protein kinase activity (By similarity).	A novel pollen-pistil interaction conferring high-temperature tolerance during reproduction via CLE45 signaling.2013 · DOI: 10.1016/j.cub.2013.06.060 RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63 Arabidopsis MAKR5 is a positive effector of BAM3-dependent CLE45 signaling.2016 · DOI: 10.15252/embr.201642450
`At4g26540`	May act as an RGF peptide receptor regulating root meristem growth.	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030029 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009266 response to temperature stimulus Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010449 root meristem growth Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0001653 peptide receptor activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G34110

ath:AT3G24240

ath:AT4G26540

ath:AT5G48940

ath:AT5G56040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.845

Rank 1 · LXL04_030029 · OH-1004

Endoplasmic reticulum0.090

Rank 2 · LXL04_030029 · OH-1004

Cytoplasm0.064

Rank 3 · LXL04_030029 · OH-1004

Nucleus0.042

Rank 4 · LXL04_030029 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_030029 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_227-70 aa

PF23598.2LRR_1482-154 aa

PF13855.13LRR_886-134 aa

PF13855.13LRR_899-158 aa

PF12799.14LRR_499-133 aa

PF23598.2LRR_14165-278 aa

PF23598.2LRR_14273-370 aa

PF13855.13LRR_8292-351 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030029	`PF08263.18`	LRRNT_2	27	70	6.8e-09	36.6
LXL04_030029	`PF23598.2`	LRR_14	82	154	9.4e-47	160.2
LXL04_030029	`PF13855.13`	LRR_8	86	134	9e-47	157.4
LXL04_030029	`PF13855.13`	LRR_8	99	158	9e-47	157.4
LXL04_030029	`PF12799.14`	LRR_4	99	133	2.8e-41	139.3
LXL04_030029	`PF23598.2`	LRR_14	165	278	9.4e-47	160.2
LXL04_030029	`PF23598.2`	LRR_14	273	370	9.4e-47	160.2
LXL04_030029	`PF13855.13`	LRR_8	292	351	9e-47	157.4
LXL04_030029	`PF23598.2`	LRR_14	363	465	9.4e-47	160.2
LXL04_030029	`PF13855.13`	LRR_8	389	447	9e-47	157.4
LXL04_030029	`PF23598.2`	LRR_14	441	516	9.4e-47	160.2
LXL04_030029	`PF23598.2`	LRR_14	477	560	9.4e-47	160.2
LXL04_030029	`PF23598.2`	LRR_14	501	659	9.4e-47	160.2
LXL04_030029	`PF12799.14`	LRR_4	509	541	2.8e-41	139.3
LXL04_030029	`PF13855.13`	LRR_8	556	616	9e-47	157.4
LXL04_030029	`PF13855.13`	LRR_8	608	663	9e-47	157.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGF5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI5	71.881%	Swiss-Prot	strong database homology
`Q9LHP4`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI1	48.130%	Swiss-Prot	moderate database homology
`C0LGV1`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI2	46.060%	Swiss-Prot	moderate database homology
`F4K6B8`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4	43.389%	Swiss-Prot	moderate database homology
`C0LGR3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI3	44.923%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card