TkA07G371230 | RubberDandelionOmics

Gene overview

TkA07G371230

Reference: TK1151 Chr: Chr07 Coordinates: 93117570-93118731 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

837 bp · TkA07G371230|TK1151|cDNA

ACTCTTTTTCTAAGATACGTACATAACAAGTTCAGTCAGCAATATAAAGCCACAATCGGAGCTGATTTTGTCACCAAAGAATTGCAAATAGATGACAGGCTTGTCACTTTACAGAAGATTTGGGACACTGCTGGACAGGAGAGGTTTCAGAGTCTTGGTGTTGCATTTTATCGTGGAGCAGATTGTTGTGTTCTTGTGTATGATGTAAATGTGATGCGGTCGTTTGATACCCTTGATAATTGGCATGAGGATTTCTCAAG...

CDS

Download CDS FASTA

426 bp · TkA07G371230|TK1151|CDS

ACTCTTTTTCTAAGATACGTACATAACAAGTTCAGTCAGCAATATAAAGCCACAATCGGAGCTGATTTTGTCACCAAAGAATTGCAAATAGATGACAGGCTTGTCACTTTACAGAAGATTTGGGACACTGCTGGACAGGAGAGGTTTCAGAGTCTTGGTGTTGCATTTTATCGTGGAGCAGATTGTTGTGTTCTTGTGTATGATGTAAATGTGATGCGGTCGTTTGATACCCTTGATAATTGGCATGAGGATTTCTCAAG...

Protein

Download Protein FASTA

141 aa · TkA07G371230|TK1151|PROTEIN

TLFLRYVHNKFSQQYKATIGADFVTKELQIDDRLVTLQKIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDTLDNWHEDFSSKANPPDPSSFPFILLGNKIDIDGGNSRVVSEKKAKEWCASKGTFLTLRHLQKKT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G371230`
TK1151 ID	TkA07G371230
OH-1004 ID	LXL04_030025
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.600
Protein coverage (%)	TK1151 92.908 / OH-1004 63.415 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G371230

Location Chr07:93117570-93118731 (-)

Description Similar to Ras-related protein Rab7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22740`	Intracellular vesicle trafficking and protein transport.	The Rab GTPase RabG3b functions in autophagy and contributes to tracheary element differentiation in Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04315.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030025 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010089 xylem development Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0010623 programmed cell death involved in cell development Biological Process

GO:0015031 protein transport Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G22740

ath:AT4G09720

ghi:107897195

ghi:107913905

gmx:100785104

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · TkA07G371230 · TK1151

Nucleus0.278

Rank 2 · TkA07G371230 · TK1151

Endoplasmic reticulum0.113

Rank 3 · TkA07G371230 · TK1151

Golgi apparatus0.099

Rank 4 · TkA07G371230 · TK1151

Lysosome / Vacuole0.076

Rank 5 · TkA07G371230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071Ras2-129 aa

PF08477Roc2-107 aa

PF00025Arf5-113 aa

PF00009GTP_EFTU39-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G371230	`PF00071`	Ras	2	129	4.7e-36	124.5
TkA07G371230	`PF08477`	Roc	2	107	6.1e-23	82.0
TkA07G371230	`PF00025`	Arf	5	113	0.00011	22.4
TkA07G371230	`PF00009`	GTP_EFTU	39	83	0.21	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04157`	Arabidopsis thaliana	sp\|O04157\|RAG3B_ARATH Ras-related protein RABG3b	80.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card