RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G370790
Reference: TK1151 Chr: Chr07 Coordinates: 92956942-92963127 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3848 bp · TkA07G370790|TK1151|cDNA

AAGAAGTGAGAGAAAGAACAGAAAGAAGTGTAGAGAGAGAGAGAGAGAGAGAGAGAGAGTTAGAGAGAGGAAAAAGCTCTCTACTATGTTCATGGGTTTCTTCAAGAGATTTGTCGTGTGAAGTGCGTTCTCTTAGATTTCCAAAAGTCTGTTTCTTTCAGTGTTTATGTGTTTAAGTTTGTGTGTATTTCGGTGATTCAATGGATACCAAAGGACGGCTTGTTGCGGGTTCACACAATCGGAATGAATTTGTTCTAATC...

CDS

Download CDS FASTA

3300 bp · TkA07G370790|TK1151|CDS

ATGGATACCAAAGGACGGCTTGTTGCGGGTTCACACAATCGGAATGAATTTGTTCTAATCAATGCGGATGAAGTTGGAAGAGTGACTTCTGTTAAAGAATTGAGTGGACAGATTTGTCAGATTTGTGGAGATGAGATTGAAATAACAGTCGATGGAGAGCCATTTGTTGCTTGCAATGAATGTGCTTTCCCGATTTGTAGGCCTTGCTATGAATATGAACGAAGGGAGGGAAATCAATCTTGTCCTCAATGCAAAACTAG...

Protein

Download Protein FASTA

1099 aa · TkA07G370790|TK1151|PROTEIN

MDTKGRLVAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDGEPFVACNECAFPICRPCYEYERREGNQSCPQCKTRYKRIKGSPRVDGDEDEEGFDDLDNEFDLANYSGRDPHNVADMAFSSRLNIGRGNSNASGFATPSEVDGATLNPEIPLLTFGQEDDGISADKHALIIPPFMNRTKRVHPMPFSDTASQVSMPPRPMDPKKDLAVYGYGTVAWKDRMEEWRKRQNDKLQMVKHEGGGGGHNDGDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G370790
TK1151 IDTkA07G370790
OH-1004 IDLXL04_030016
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G370790
LocationChr07:92956942-92963127 (+)
DescriptionSimilar to CESA6: Cellulose synthase A catalytic subunit 6 [UDP-forming]
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g39350 Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.
Functional analysis of the cellulose synthase genes CesA1, CesA2, and CesA3 in Arabidopsis.2002 · DOI: 10.1104/pp.010931
Knockout of the AtCESA2 gene affects microtubule orientation and causes abnormal cell expansion in Arabidopsis.2007 · DOI: 10.1104/pp.106.088393
Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104
At5g64740 Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.
PROCUSTE1 encodes a cellulose synthase required for normal cell elongation specifically in roots and dark-grown hypocotyls of Arabidopsis.2000 · DOI: 10.1105/tpc.12.12.2409
Resistance against herbicide isoxaben and cellulose deficiency caused by distinct mutations in same cellulose synthase isoform CESA6.2002 · DOI: 10.1104/pp.010822
Genetic evidence for three unique components in primary cell-wall cellulose synthase complexes in Arabidopsis.2007 · DOI: 10.1073/pnas.0706592104
Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104
At2g21770 Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation. No verified direct reference in this release
At5g09870 Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.
Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0424400 Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030016 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009825 multidimensional cell growth Biological Process
GO:0009832 plant-type cell wall biogenesis Biological Process
GO:0009833 plant-type primary cell wall biogenesis Biological Process
GO:0009834 plant-type secondary cell wall biogenesis Biological Process
GO:0010192 mucilage biosynthetic process Biological Process
GO:0010214 seed coat development Biological Process
GO:0030244 cellulose biosynthetic process Biological Process
GO:0043622 cortical microtubule organization Biological Process
GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process
GO:0071555 cell wall organization Biological Process
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT2G21770
ath:AT4G39350
ath:AT5G09870
ath:AT5G64740
dosa:Os07g0424400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.563
Rank 1 · TkA07G370790 · TK1151
Endoplasmic reticulum0.189
Rank 2 · TkA07G370790 · TK1151
Golgi apparatus0.158
Rank 3 · TkA07G370790 · TK1151
Cytoplasm0.143
Rank 4 · TkA07G370790 · TK1151
Lysosome / Vacuole0.104
Rank 5 · TkA07G370790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14569zf-UDP30-104 aa
PF02318FYVE_230-87 aa
PF14446Prok-RING_137-73 aa
PF14570zf-RING_439-89 aa
PF00097zf-C3HC439-84 aa
PF14446Prok-RING_181-90 aa
PF03552Cellulose_synt369-1086 aa
PF13641Glyco_tranf_2_3385-409 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G370790PF14569zf-UDP301042.7e-41140.2
TkA07G370790PF02318FYVE_230870.01216.5
TkA07G370790PF14446Prok-RING_137730.01915.8
TkA07G370790PF14570zf-RING_439891.4e-0525.4
TkA07G370790PF00097zf-C3HC439840.8610.2
TkA07G370790PF14446Prok-RING_181900.01915.8
TkA07G370790PF03552Cellulose_synt36910861345.4
TkA07G370790PF13641Glyco_tranf_2_33854090.1312.7
TkA07G370790PF13632Glyco_trans_2_35876561.9e-0628.6
TkA07G370790PF20322DUF66176867290.310.9
TkA07G370790PF13632Glyco_trans_2_37898941.9e-0628.6
TkA07G370790PF13641Glyco_tranf_2_37948420.1312.7
TkA07G370790PF13632Glyco_trans_2_3102510741.9e-0628.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O48947Arabidopsis thalianasp|O48947|CESA2_ARATH Cellulose synthase A catalytic subunit 2 [UDP-forming]78.800%Swiss-ProtHigh
Q94JQ6Arabidopsis thalianasp|Q94JQ6|CESA6_ARATH Cellulose synthase A catalytic subunit 6 [UDP-forming]77.000%Swiss-ProtHigh
Q9SJ22Arabidopsis thalianasp|Q9SJ22|CESA9_ARATH Probable cellulose synthase A catalytic subunit 9 [UDP-forming]75.700%Swiss-ProtHigh
Q8L778Arabidopsis thalianasp|Q8L778|CESA5_ARATH Cellulose synthase A catalytic subunit 5 [UDP-forming]77.200%Swiss-ProtHigh
Q69V23Oryza sativa subsp. japonicasp|Q69V23|CESA3_ORYSJ Probable cellulose synthase A catalytic subunit 3 [UDP-forming]72.200%Swiss-ProtHigh

JBrowse

View in Genome Browser