LXL04_030016 | RubberDandelionOmics

Gene overview

LXL04_030016

Reference: OH-1004 Chr: Chr06 Coordinates: 105804002-105809653 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3300 bp · LXL04_030016|LXL04_030016|OH1004|cDNA

ATGGATACCAAAGGACGGCTTGTTGCGGGTTCACACAATCGGAATGAATTTGTTCTAATCAATGCGGATGAAGTTGGAAGAGTGACTTCTGTTAAAGAATTGAGTGGACAGATTTGTCAGATTTGTGGAGATGAGATTGAAATAACAGTCGATGGAGAGCCATTTGTTGCTTGCAATGAATGTGCTTTCCCGATTTGTAGACCTTGCTATGAATATGAACGAAGGGAGGGAAATCAATCTTGTCCTCAATGCAAAACTAG...

CDS

Download CDS FASTA

3300 bp · LXL04_030016|LXL04_030016|OH1004|CDS

ATGGATACCAAAGGACGGCTTGTTGCGGGTTCACACAATCGGAATGAATTTGTTCTAATCAATGCGGATGAAGTTGGAAGAGTGACTTCTGTTAAAGAATTGAGTGGACAGATTTGTCAGATTTGTGGAGATGAGATTGAAATAACAGTCGATGGAGAGCCATTTGTTGCTTGCAATGAATGTGCTTTCCCGATTTGTAGACCTTGCTATGAATATGAACGAAGGGAGGGAAATCAATCTTGTCCTCAATGCAAAACTAG...

Protein

Download Protein FASTA

1099 aa · LXL04_030016|LXL04_030016|OH1004|PROTEIN

MDTKGRLVAGSHNRNEFVLINADEVGRVTSVKELSGQICQICGDEIEITVDGEPFVACNECAFPICRPCYEYERREGNQSCPQCKTRYKRIKGSPRVDGDEDEEGFDDLDNEFDLANYSGRDPHNVADMAFSSRLNIGRGNSNASGFATPSEVDGATLNPEIPLLTFGQEDDGISADKHALIIPPFMNRTKRVHPMPFSDTASQVSMPPRPMDPKKDLAVYGYGTVAWKDRMEEWRKRQNDKLQMVKHEGGGGGHNDGDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030016`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030016

Location Chr06:105804002-105809653 (+)

Description Similar to CESA6: Cellulose synthase A catalytic subunit 6 [UDP-forming]

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64740`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	PROCUSTE1 encodes a cellulose synthase required for normal cell elongation specifically in roots and dark-grown hypocotyls of Arabidopsis.2000 · DOI: 10.1105/tpc.12.12.2409 Resistance against herbicide isoxaben and cellulose deficiency caused by distinct mutations in same cellulose synthase isoform CESA6.2002 · DOI: 10.1104/pp.010822 Genetic evidence for three unique components in primary cell-wall cellulose synthase complexes in Arabidopsis.2007 · DOI: 10.1073/pnas.0706592104 Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104
`At2g21770`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release
`At5g09870`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104
`At4g39350`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	Functional analysis of the cellulose synthase genes CesA1, CesA2, and CesA3 in Arabidopsis.2002 · DOI: 10.1104/pp.010931 Knockout of the AtCESA2 gene affects microtubule orientation and causes abnormal cell expansion in Arabidopsis.2007 · DOI: 10.1104/pp.106.088393 Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0424400`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030016 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009825 multidimensional cell growth Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0010214 seed coat development Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G21770

ath:AT4G39350

ath:AT5G09870

ath:AT5G64740

dosa:Os07g0424400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.568

Rank 1 · LXL04_030016 · OH-1004

Endoplasmic reticulum0.189

Rank 2 · LXL04_030016 · OH-1004

Golgi apparatus0.155

Rank 3 · LXL04_030016 · OH-1004

Cytoplasm0.141

Rank 4 · LXL04_030016 · OH-1004

Lysosome / Vacuole0.102

Rank 5 · LXL04_030016 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14569.13zf-UDP30-104 aa

PF03552.21Cellulose_synt369-1086 aa

PF13632.13Glyco_trans_2_3789-894 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030016	`PF14569.13`	zf-UDP	30	104	2.7e-41	140.2
LXL04_030016	`PF03552.21`	Cellulose_synt	369	1086		1345.0
LXL04_030016	`PF13632.13`	Glyco_trans_2_3	789	894	1.9e-06	28.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JQ6`	Arabidopsis thaliana	Cellulose synthase A catalytic subunit 6 [UDP-forming]	77.475%	Swiss-Prot	strong database homology
`Q9SJ22`	Arabidopsis thaliana	Probable cellulose synthase A catalytic subunit 9 [UDP-forming]	76.519%	Swiss-Prot	strong database homology
`Q8L778`	Arabidopsis thaliana	Cellulose synthase A catalytic subunit 5 [UDP-forming]	77.748%	Swiss-Prot	strong database homology
`O48947`	Arabidopsis thaliana	Cellulose synthase A catalytic subunit 2 [UDP-forming]	78.391%	Swiss-Prot	strong database homology
`Q69V23`	Oryza sativa subsp. japonica	Probable cellulose synthase A catalytic subunit 3 [UDP-forming]	71.403%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card