TkA07G369070 | RubberDandelionOmics

Gene overview

TkA07G369070

Reference: TK1151 Chr: Chr07 Coordinates: 92539176-92543068 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1478 bp · TkA07G369070|TK1151|cDNA

ATCAACTAAAACCAAAGAGAACGAAAAAAATTCAAAGAGAGCCATGATGAATTTACCCAGACTAGTAAAGGCTTATGAGAGCAACAAACCATACATAGCCATGCTTCTAGTGCAAGCAATATATGCAGGCATGGCTTTGTTATCCAAAGCATCCATTTCTTCCGGAATGAATCCTTCCATTTTTGTTGTTTATCGTCAAGCTTTTGCCACTCTCGCACTCGCCCCACTTGTATACTTCTTTGAAAGGAACGATGTCCCTC...

CDS

Download CDS FASTA

1083 bp · TkA07G369070|TK1151|CDS

ATGATGAATTTACCCAGACTAGTAAAGGCTTATGAGAGCAACAAACCATACATAGCCATGCTTCTAGTGCAAGCAATATATGCAGGCATGGCTTTGTTATCCAAAGCATCCATTTCTTCCGGAATGAATCCTTCCATTTTTGTTGTTTATCGTCAAGCTTTTGCCACTCTCGCACTCGCCCCACTTGTATACTTCTTTGAAAGGAACGATGTCCCTCGGTTATCCTATAGCTTGATGTGGAAGATTTTCTTCAGTTCTTT...

Protein

Download Protein FASTA

360 aa · TkA07G369070|TK1151|PROTEIN

MMNLPRLVKAYESNKPYIAMLLVQAIYAGMALLSKASISSGMNPSIFVVYRQAFATLALAPLVYFFERNDVPRLSYSLMWKIFFSSLIGLTICLNMYYHALNHTSATFAAASTNLVPAITFVIALMLRMERIYIKELHGWAKLIGSIVSVCGALVFAFYRGPSLNFMKWHTSGETSEVASTTDVFSSTEELIKGPLAILSANILWSCWSILQAPIMKEYPAKLSLITLQCFFSLIQSTVWAAVMERNISSWKLGWDLNLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G369070`
TK1151 ID	TkA07G369070
OH-1004 ID	LXL04_029997
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G369070

Location Chr07:92539176-92543068 (+)

Description Similar to At1g43650: WAT1-related protein At1g43650

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g43650`	WAT1-related protein At1g43650.	No verified direct reference in this release
`At5g64700`	WAT1-related protein At5g64700.	No verified direct reference in this release
`At5g07050`	WAT1-related protein At5g07050.	No verified direct reference in this release
`At2g40900`	WAT1-related protein At2g40900.	No verified direct reference in this release
`At3g56620`	WAT1-related protein At3g56620.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029997 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048316 seed development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015186 L-glutamine transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G21890

ath:AT1G43650

ath:AT2G40900

ath:AT5G07050

ath:AT5G64700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.423

Rank 1 · TkA07G369070 · TK1151

Lysosome / Vacuole0.208

Rank 2 · TkA07G369070 · TK1151

Endoplasmic reticulum0.201

Rank 3 · TkA07G369070 · TK1151

Golgi apparatus0.083

Rank 4 · TkA07G369070 · TK1151

Cytoplasm0.072

Rank 5 · TkA07G369070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA17-148 aa

PF10856DUF267846-101 aa

PF10639TMEM23496-153 aa

PF00892EamA193-331 aa

PF10639TMEM234291-329 aa

PF10856DUF2678296-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G369070	`PF00892`	EamA	17	148	1.4e-25	90.8
TkA07G369070	`PF10856`	DUF2678	46	101	8.7	7.1
TkA07G369070	`PF10639`	TMEM234	96	153	2.2	9.1
TkA07G369070	`PF00892`	EamA	193	331	1.4e-25	90.8
TkA07G369070	`PF10639`	TMEM234	291	329	2.2	9.1
TkA07G369070	`PF10856`	DUF2678	296	311	8.7	7.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NMB7`	Arabidopsis thaliana	sp\|Q6NMB7\|WTR7_ARATH WAT1-related protein At1g43650	51.900%	Swiss-Prot	High
`Q9FGG3`	Arabidopsis thaliana	sp\|Q9FGG3\|WTR45_ARATH WAT1-related protein At5g64700	48.900%	Swiss-Prot	Medium
`Q9FL41`	Arabidopsis thaliana	sp\|Q9FL41\|WTR38_ARATH WAT1-related protein At5g07050	41.100%	Swiss-Prot	Medium
`F4IJ08`	Arabidopsis thaliana	sp\|F4IJ08\|WTR15_ARATH WAT1-related protein At2g40900	38.700%	Swiss-Prot	Medium
`Q9LXX8`	Arabidopsis thaliana	sp\|Q9LXX8\|WTR27_ARATH WAT1-related protein At3g56620	36.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card