LXL04_029997 | RubberDandelionOmics

Gene overview

LXL04_029997

Reference: OH-1004 Chr: Chr06 Coordinates: 105449939-105453170 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_029997|LXL04_029997|OH1004|cDNA

ATGATGAATTTACCCAGACTAGTAAAGGCTTATGAGAGCAACAAACCATACATAGCCATGCTTCTAGTGCAAGCAATATATGCAGGCATGGCTTTGTTATCCAAAGCATCCATTTCTTCCGGAATGAATCCTTCCATTTTTGTTGTTTATCGTCAAGCTTTTGCCACTCTCGCACTCGCCCCACTTGTATACTTCTTTGAAAGGAACGATGTCCCTCGGTTATCCTATAGCTTGATGTGGAAGATTTTCTTCAGTTCTTT...

CDS

Download CDS FASTA

1083 bp · LXL04_029997|LXL04_029997|OH1004|CDS

ATGATGAATTTACCCAGACTAGTAAAGGCTTATGAGAGCAACAAACCATACATAGCCATGCTTCTAGTGCAAGCAATATATGCAGGCATGGCTTTGTTATCCAAAGCATCCATTTCTTCCGGAATGAATCCTTCCATTTTTGTTGTTTATCGTCAAGCTTTTGCCACTCTCGCACTCGCCCCACTTGTATACTTCTTTGAAAGGAACGATGTCCCTCGGTTATCCTATAGCTTGATGTGGAAGATTTTCTTCAGTTCTTT...

Protein

Download Protein FASTA

360 aa · LXL04_029997|LXL04_029997|OH1004|PROTEIN

MMNLPRLVKAYESNKPYIAMLLVQAIYAGMALLSKASISSGMNPSIFVVYRQAFATLALAPLVYFFERNDVPRLSYSLMWKIFFSSLIGLTICLNMYYHALNHTSATFAAASTNLVPAITFVIALMLRMERIYIKELHGWAKLIGSIVSVCGALVFAFYRGPSLNFMKWHTSGETSEVASTTDVFSSTEELIKGPLAILSANILWSCWSILQAPIMKEYPAKLSLITLQCFFSLIQSTVWAAVMERNISSWKLGWDLNLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029997`
TK1151 ID	TkA07G369070
OH-1004 ID	LXL04_029997
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029997

Location Chr06:105449939-105453170 (+)

Description Similar to At1g43650: WAT1-related protein At1g43650

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g43650`	WAT1-related protein At1g43650.	No verified direct reference in this release
`At5g64700`	WAT1-related protein At5g64700.	No verified direct reference in this release
`At5g07050`	WAT1-related protein At5g07050.	No verified direct reference in this release
`At2g40900`	WAT1-related protein At2g40900.	No verified direct reference in this release
`At1g21890`	WAT1-related protein At1g21890.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029997 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048316 seed development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015186 L-glutamine transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G21890

ath:AT1G43650

ath:AT2G40900

ath:AT5G07050

ath:AT5G64700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.423

Rank 1 · LXL04_029997 · OH-1004

Lysosome / Vacuole0.208

Rank 2 · LXL04_029997 · OH-1004

Endoplasmic reticulum0.201

Rank 3 · LXL04_029997 · OH-1004

Golgi apparatus0.083

Rank 4 · LXL04_029997 · OH-1004

Cytoplasm0.072

Rank 5 · LXL04_029997 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892.27EamA17-148 aa

PF00892.27EamA193-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029997	`PF00892.27`	EamA	17	148	1.4e-25	90.8
LXL04_029997	`PF00892.27`	EamA	193	331	1.4e-25	90.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NMB7`	Arabidopsis thaliana	WAT1-related protein At1g43650	52.187%	Swiss-Prot	strong database homology
`Q9FGG3`	Arabidopsis thaliana	WAT1-related protein At5g64700	47.175%	Swiss-Prot	moderate database homology
`Q9FL41`	Arabidopsis thaliana	WAT1-related protein At5g07050	40.774%	Swiss-Prot	moderate database homology
`F4IJ08`	Arabidopsis thaliana	WAT1-related protein At2g40900	37.758%	Swiss-Prot	moderate database homology
`F4HZQ7`	Arabidopsis thaliana	WAT1-related protein At1g21890	37.160%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card