TkA07G367850 | RubberDandelionOmics

Gene overview

TkA07G367850

Reference: TK1151 Chr: Chr07 Coordinates: 92192264-92196103 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1605 bp · TkA07G367850|TK1151|cDNA

GTAATACTTGTTAAGTAGAAGGACCAAAATGAAAATAGTTTCGTAGTACAAGCCAAATGTCCAAAAAGAGTATTTGTCGAACTCCCGCTACCTTCCATAGCCGAAGAAGAAGCAGCCAACTTCCTTCTTTTACAGTTATCCTCCTGACGACCTCTAGCGTCACCGTCACGCTGTACTCCGCCACGTGTCATCTAAACTTCCACTGACCTCAGATAACCTCATCCTCGATCCCCGTGTACATAATAAGGATGCTATTATCT...

CDS

Download CDS FASTA

1026 bp · TkA07G367850|TK1151|CDS

ATGGATCATGAAGCGGATGCCTTCCGGACGGATTTGATGACCATAACTCGGTTTGTGCTGAATGAACAGTCGAAGCATCCGGAGTCACGAGGGGATTTCAGTATCCTGCTCAGTAACATTGTTCTAGGTTGCAAGTTCGTCTGCTCCGCTGTTAACAAGGCAGGTTTGGCAAAACTCATTGGACTTGCAGGGGAGACGAATGTGCAGGGAGAAGAACAGAAGAAATTGGACGTTCTCTCAAATGAAGTTTTCGTAAAAGC...

Protein

Download Protein FASTA

341 aa · TkA07G367850|TK1151|PROTEIN

MDHEADAFRTDLMTITRFVLNEQSKHPESRGDFSILLSNIVLGCKFVCSAVNKAGLAKLIGLAGETNVQGEEQKKLDVLSNEVFVKALVSSGRTSILVSEEDEEAIFVEKSKRGKYCVVFDPLDGSSNIDCGVSIGTIFGIYMIKDGHDACIEDVLQPGKEMLAAGYCMYGSSCTLVLSTGSGVNGFTLDPSLGEFILTHPDIKTPKKGKIYSVNEGNAKNWDGPTAKYVERCKYPTDGSPAKSLRYIGSMVADVHRTLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G367850`
TK1151 ID	TkA07G367850
OH-1004 ID	LXL04_029991
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G367850

Location Chr07:92192264-92196103 (+)

Description Similar to Fructose-1,6-bisphosphatase, cytosolic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WXB2`	Fructose-1,6-bisphosphatase, cytosolic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029991 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0005986 sucrose biosynthetic process Biological Process

GO:0006000 fructose metabolic process Biological Process

GO:0006002 fructose 6-phosphate metabolic process Biological Process

GO:0006094 gluconeogenesis Biological Process

GO:0015979 photosynthesis Biological Process

GO:0030388 fructose 1,6-bisphosphate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0042132 fructose 1,6-bisphosphate 1-phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

bna:106401056

dosa:Os01g0866400

sot:102588954

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.773

Rank 1 · TkA07G367850 · TK1151

Nucleus0.355

Rank 2 · TkA07G367850 · TK1151

Endoplasmic reticulum0.071

Rank 3 · TkA07G367850 · TK1151

Lysosome / Vacuole0.056

Rank 4 · TkA07G367850 · TK1151

Golgi apparatus0.053

Rank 5 · TkA07G367850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00316FBPase13-201 aa

PF00459Inositol_P68-128 aa

PF18345zf_CCCH_4165-175 aa

PF18913FBPase_C206-334 aa

PF18345zf_CCCH_4232-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G367850	`PF00316`	FBPase	13	201	1e-84	283.6
TkA07G367850	`PF00459`	Inositol_P	68	128	0.033	14.4
TkA07G367850	`PF18345`	zf_CCCH_4	165	175	0.26	12.2
TkA07G367850	`PF18913`	FBPase_C	206	334	5e-50	169.3
TkA07G367850	`PF18345`	zf_CCCH_4	232	235	0.26	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2WXB2`	Oryza sativa subsp. indica	sp\|A2WXB2\|F16P2_ORYSI Fructose-1,6-bisphosphatase, cytosolic	87.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card