Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1506 bp · TkA07G360560|TK1151|cDNA
ATGGTGGAGGAGCGCGATAAGCAGATTTGCGATGCTTTGTTCTCCGACCTCTCGAAGCCTGAGATGGAAGCTTTCATCCACGAGGTGAATTATTGTAAAAAATTCATTGAAGGTGTCACTGAAGAACTCAAAGAATGGATGAAACCAGAAAAGGTGAAAACCAAATTAGGCACTTTCCCTTCATCAGCAGAAATAGTCCCAGAACCCTGGGGGTTGTTTTTGGTCATTTCAGCATGGAACTATCCTTTCTTGTTATCTGT...
441 bp · TkA07G360560|TK1151|CDS
ATGGTGGAGGAGCGCGATAAGCAGATTTGCGATGCTTTGTTCTCCGACCTCTCGAAGCCTGAGATGGAAGCTTTCATCCACGAGGTGAATTATTGTAAAAAATTCATTGAAGGTGTCACTGAAGAACTCAAAGAATGGATGAAACCAGAAAAGGTGAAAACCAAATTAGGCACTTTCCCTTCATCAGCAGAAATAGTCCCAGAACCCTGGGGGTTGTTTTTGGTCATTTCAGCATGGAACTATCCTTTCTTGTTATCTGT...
Protein
Download Protein FASTA146 aa · TkA07G360560|TK1151|PROTEIN
MVEERDKQICDALFSDLSKPEMEAFIHEVNYCKKFIEGVTEELKEWMKPEKVKTKLGTFPSSAEIVPEPWGLFLVISAWNYPFLLSVDPIIGAIAAGNAVVLKPSEVAPAMSSLLKKLLEEYLDNSAVKSSKVVFQKLPPSWSKVG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G360560 |
|---|---|
| TK1151 ID | TkA07G360560 |
| OH-1004 ID | LXL04_029936 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 87.600 |
| Protein coverage (%) | TK1151 88.356 / OH-1004 26.434Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G360560 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:90334948-90339217 (+) | |||||||||
| Description | Similar to ALDH3H1: Aldehyde dehydrogenase family 3 member H1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001666 response to hypoxia Biological Process GO:0006081 aldehyde metabolic process Biological Process GO:0006629 lipid metabolic process Biological Process GO:0007584 response to nutrient Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0009269 response to desiccation Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0051384 response to glucocorticoid Biological Process GO:0051591 response to cAMP Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G44170 ath:AT4G34240 ath:AT4G36250 rno:25375 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00171Aldedh2-121 aaPF17117DUF51042-50 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G360560 | PF00171 | Aldedh | 2 | 121 | 5.8e-20 | 72.0 |
| TkA07G360560 | PF17117 | DUF5104 | 2 | 50 | 0.12 | 13.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.