LXL04_029936 | RubberDandelionOmics

Gene overview

LXL04_029936

Reference: OH-1004 Chr: Chr06 Coordinates: 103608832-103611761 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1467 bp · LXL04_029936|LXL04_029936|OH1004|cDNA

ATGGCCTCCGAACAAGTGAAGAATTCTGCATTCGATACAGAGGCTGCCAGCTGTTTAGTCAAGGAGTTGCGACACACAGtcctcgccggaaaaacaaagAGCTACGAATGGAGAGTATCACAGTTGAAGGGTTTGTTGAAGATGGTGGAGGAGCGCGATAAGCAGATTTGCGATGCTTTGTTCTCCGACCTCTCGAAGCCTGAGATGGAAGCTTTCATCCACGAGattgttttggtaaaaaattcATTGAAGGTGTCACT...

CDS

Download CDS FASTA

1467 bp · LXL04_029936|LXL04_029936|OH1004|CDS

ATGGCCTCCGAACAAGTGAAGAATTCTGCATTCGATACAGAGGCTGCCAGCTGTTTAGTCAAGGAGTTGCGACACACAGTCCTCGCCGGAAAAACAAAGAGCTACGAATGGAGAGTATCACAGTTGAAGGGTTTGTTGAAGATGGTGGAGGAGCGCGATAAGCAGATTTGCGATGCTTTGTTCTCCGACCTCTCGAAGCCTGAGATGGAAGCTTTCATCCACGAGATTGTTTTGGTAAAAAATTCATTGAAGGTGTCACT...

Protein

Download Protein FASTA

488 aa · LXL04_029936|LXL04_029936|OH1004|PROTEIN

MASEQVKNSAFDTEAASCLVKELRHTVLAGKTKSYEWRVSQLKGLLKMVEERDKQICDALFSDLSKPEMEAFIHEIVLVKNSLKVSLKKLKEWMKPEKVKTKLGTFPSSAEIVPEPLGVVLVISAWNYPFLLSVDPIIGAIAAGNAVVLKPSEVAPAMSSLLKKLLEEYLDNSAVKIVEGGVSETSTLLEQKWDKIFYTGNGRVARVVMAAAAKNLTPVVLELGGKSPVVVDSDVDLTVTARRIIGGKWACNNGQACVAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029936`
TK1151 ID	TkA07G360560
OH-1004 ID	LXL04_029936
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.600
Protein coverage (%)	TK1151 88.356 / OH-1004 26.434 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029936

Location Chr06:103608832-103611761 (+)

Description Similar to ALDH3H1: Aldehyde dehydrogenase family 3 member H1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g44170`	Involved in oxidative stress tolerance by detoxifying reactive aldehydes derived from lipid peroxidation.	Engineering the nucleotide coenzyme specificity and sulfhydryl redox sensitivity of two stress-responsive aldehyde dehydrogenase isoenzymes of Arabidopsis thaliana.2011 · DOI: 10.1042/bj20101337
`At4g34240`	Involved in oxidative stress tolerance by detoxifying reactive aldehydes derived from lipid peroxidation.	Engineering the nucleotide coenzyme specificity and sulfhydryl redox sensitivity of two stress-responsive aldehyde dehydrogenase isoenzymes of Arabidopsis thaliana.2011 · DOI: 10.1042/bj20101337
`At4g36250`	Aldehyde dehydrogenase family 3 member F1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029936 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006081 aldehyde metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0007584 response to nutrient Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009269 response to desiccation Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0051384 response to glucocorticoid Biological Process

GO:0051591 response to cAMP Biological Process

KEGG gene cross-reference

ath:AT1G44170

ath:AT4G34240

ath:AT4G36250

rno:25375

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.337

Rank 1 · LXL04_029936 · OH-1004

Peroxisome0.293

Rank 2 · LXL04_029936 · OH-1004

Mitochondrion0.144

Rank 3 · LXL04_029936 · OH-1004

Endoplasmic reticulum0.127

Rank 4 · LXL04_029936 · OH-1004

Nucleus0.093

Rank 5 · LXL04_029936 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171.28Aldedh34-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029936	`PF00171.28`	Aldedh	34	445	8.4e-81	272.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q70DU8`	Arabidopsis thaliana	Aldehyde dehydrogenase family 3 member H1	66.461%	Swiss-Prot	strong database homology
`Q8W033`	Arabidopsis thaliana	Aldehyde dehydrogenase family 3 member I1, chloroplastic	62.083%	Swiss-Prot	strong database homology
`Q70E96`	Arabidopsis thaliana	Aldehyde dehydrogenase family 3 member F1	45.319%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card