TkA07G360160 | RubberDandelionOmics

Gene overview

TkA07G360160

Reference: TK1151 Chr: Chr07 Coordinates: 90216552-90220707 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1983 bp · TkA07G360160|TK1151|cDNA

CTTATCCATCAATTTGACTGCTTTGCTACTTTGACTAATTATCGTTTTTTATTCTTCAAAATTCCAGTCTCTCTCTCTGCAGTTTCTTGTGATTTCTCCTTCTATAACAAACACACCATCCTTTTATAAAAAAAGCTGCCAAGGCCTTATAATCATGACACTACACATTGTTAACATTTTGCTATATACACAGAGAAACTGTTCCATTTCTGAATTCTGATGCTCAACTCTCTCAATTTTCACTTGCTTATCCTTAACGG...

CDS

Download CDS FASTA

1410 bp · TkA07G360160|TK1151|CDS

ATGGGTGCTGGGTTGTTGGCTGCGGCGGCGCTAGTGGTCGTGCTGCTAGTAAGCGGCGTAAATGGTTTTCCGGCGGAGGATCTGGTGGTGAAATTGCCTGGACAACCAACTGTTGGTTTTAGACAGTATGCTGGGTATGTAGACGTGGATTTGAAGGCTGGGAGGAGTTTGTTTTATTACTTCGTTGAAGCCGATAAGGATGCTGATCGTAAACCCCTCACTCTTTGGCTCAATGGAGGCCCAGGATGCTCATCGATGGG...

Protein

Download Protein FASTA

469 aa · TkA07G360160|TK1151|PROTEIN

MGAGLLAAAALVVVLLVSGVNGFPAEDLVVKLPGQPTVGFRQYAGYVDVDLKAGRSLFYYFVEADKDADRKPLTLWLNGGPGCSSMGGGAFTELGPFFPQGDGRGLRRNTKSWNKVSNLLFVESPAGVGWSYSNTSSDYTTGDANTARDMHTFLMYWYKKFPSFRSRDLYVTGESYAGHYIPQLAIALLDHNEHSNGFKFKIKGVLIGNPLLKLDRDVPAVYEYYWSHGMISDEIGLTIMNDCNFEDYTFPSPHNESIAC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G360160`
TK1151 ID	TkA07G360160
OH-1004 ID	LXL04_009300
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.500
Protein coverage (%)	TK1151 95.309 / OH-1004 96.095 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G360160

Location Chr07:90216552-90220707 (-)

Description Similar to SCPL45: Serine carboxypeptidase-like 45

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42240`	Probable carboxypeptidase.	No verified direct reference in this release
`At1g43780`	Probable carboxypeptidase.	No verified direct reference in this release
`At5g42230`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g12480`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g33530`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009300 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28110

ath:AT1G43780

ath:AT2G33530

ath:AT5G42230

ath:AT5G42240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.579

Rank 1 · TkA07G360160 · TK1151

Extracellular0.220

Rank 2 · TkA07G360160 · TK1151

Cytoplasm0.107

Rank 3 · TkA07G360160 · TK1151

Endoplasmic reticulum0.085

Rank 4 · TkA07G360160 · TK1151

Cell membrane0.083

Rank 5 · TkA07G360160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S1033-456 aa

PF12146Hydrolase_4145-217 aa

PF12146Hydrolase_4366-396 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G360160	`PF00450`	Peptidase_S10	33	456	1.6e-132	443.6
TkA07G360160	`PF12146`	Hydrolase_4	145	217	0.074	13.1
TkA07G360160	`PF12146`	Hydrolase_4	366	396	0.074	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH05`	Arabidopsis thaliana	sp\|Q9FH05\|SCP42_ARATH Serine carboxypeptidase-like 42	76.700%	Swiss-Prot	High
`Q9MAR8`	Arabidopsis thaliana	sp\|Q9MAR8\|SCP44_ARATH Serine carboxypeptidase-like 44	72.000%	Swiss-Prot	High
`Q9FH06`	Arabidopsis thaliana	sp\|Q9FH06\|SCP41_ARATH Serine carboxypeptidase-like 41	70.200%	Swiss-Prot	High
`Q84W27`	Arabidopsis thaliana	sp\|Q84W27\|SCP43_ARATH Serine carboxypeptidase-like 43	66.700%	Swiss-Prot	High
`Q8VY01`	Arabidopsis thaliana	sp\|Q8VY01\|SCP46_ARATH Serine carboxypeptidase-like 46	46.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card