Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2620 bp · TkA07G341880|TK1151|cDNA
TTTTGCTCTACATTTTCTCGTGACCATACACATTTAAAACTCTCCTTATAATTCTCCAACACTATTCTCTTCTGCTTTACAGAATTAAACTCAATAAGTTGAAATACAAGCCACCATAACTTTACCAAACTAACAAATGCAATAAAACTTTAACAAATGACATCTCAAACTTCATCCGATGTCGAAAATCCAACTCACACCTCTCATATCGAAGCCGATAACAGCTATGTCCCATTGTTAGACGCAAATCTACATTCTAA...
1515 bp · TkA07G341880|TK1151|CDS
ATGGTTCATTGGCGACACCTTCCAATTGCAATGGAAAGGGACCAGTGGTATGATGTCAATGGTGTATGGACCGGATCCACAACCATTTTACCAAATAACAAACTTGTGGTACTCTACACCGGTTCAACTAACGAATCAGTCCAAGTCCAAAACCTAGCATACCCTGCTAACCCATCTGACCCACTCCTAGTCAATTGGGTCAAGGACCCTGCAAACCCGGTCCTGGTCCCACCATCGTGGATCAACATAAAGGACTTCCG...
Protein
Download Protein FASTA504 aa · TkA07G341880|TK1151|PROTEIN
MVHWRHLPIAMERDQWYDVNGVWTGSTTILPNNKLVVLYTGSTNESVQVQNLAYPANPSDPLLVNWVKDPANPVLVPPSWINIKDFRDPTTAWLTPEGKWRMVIGSKVNRTGIALLYDTEDFKSYELQDGWLHDVAGTGMWECVDFYPVSKDEFGLDTGTFGPGVKYVLKASMDDDRCDYYALGDYYLKEGKWVPDDRKIDVGIGLRYDYGIYYASKTFYDQHKKRRILWSWIKETDSEKSDIKKGWASLMALPRTVALD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G341880 |
|---|---|
| TK1151 ID | TkA07G341880 |
| OH-1004 ID | LXL04_029725 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 75.676Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G341880 |
|---|---|
| Location | Chr07:85341251-85344534 (-) |
| Description | Similar to Acid beta-fructofuranosidase 2, vacuolar |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0005985 sucrose metabolic process Biological Process GO:0009617 response to bacterium Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0071370 cellular response to gibberellin stimulus Biological Process GO:0080022 primary root development Biological Process GO:0000139 Golgi membrane Cellular Component GO:0000325 plant-type vacuole Cellular Component GO:0005773 vacuole Cellular Component GO:0005774 vacuolar membrane Cellular Component GO:0005775 vacuolar lumen Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component |
| KEGG gene cross-reference | ath:AT1G12240 vra:106768621 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00251Glyco_hydro_32N1-271 aaPF08244Glyco_hydro_32C274-466 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G341880 | PF00251 | Glyco_hydro_32N | 1 | 271 | 1.4e-70 | 239.0 |
| TkA07G341880 | PF08244 | Glyco_hydro_32C | 274 | 466 | 3e-23 | 83.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.