LXL04_029725 | RubberDandelionOmics

Gene overview

LXL04_029725

Reference: OH-1004 Chr: Chr06 Coordinates: 98639970-98642642 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2001 bp · LXL04_029725|LXL04_029725|OH1004|cDNA

ATGACATCTCAAACTTCATCGGATGTCGAAAATCCAACTCACACCTCTCATATCGAAGCCGATAACAGCTATGTCCCATTGTTAGACGCAAATCTACATTCTAAAGCTAAAGAAAATGACCAACAACCCAGTAAAACACTTCTACTATTGATATCTGGGTTGTTGGCCATCAGCTTGTTGGTGGCATTGATCGTGGGAAACATCCAATACCACTCACATAACAACGATGTTCGGTTACCAGAAAGGATGGATCCCGTTGA...

CDS

Download CDS FASTA

2001 bp · LXL04_029725|LXL04_029725|OH1004|CDS

ATGACATCTCAAACTTCATCGGATGTCGAAAATCCAACTCACACCTCTCATATCGAAGCCGATAACAGCTATGTCCCATTGTTAGACGCAAATCTACATTCTAAAGCTAAAGAAAATGACCAACAACCCAGTAAAACACTTCTACTATTGATATCTGGGTTGTTGGCCATCAGCTTGTTGGTGGCATTGATCGTGGGAAACATCCAATACCACTCACATAACAACGATGTTCGGTTACCAGAAAGGATGGATCCCGTTGA...

Protein

Download Protein FASTA

666 aa · LXL04_029725|LXL04_029725|OH1004|PROTEIN

MTSQTSSDVENPTHTSHIEADNSYVPLLDANLHSKAKENDQQPSKTLLLLISGLLAISLLVALIVGNIQYHSHNNDVRLPERMDPVEQGVSEKSFRLPANVSSFSWDTDMLDWQAPAFHFYPGENWMNGPVFYKGWYHLFYQYSPEAAVWGPIVWGHAVSRDMVHWRHLPIAMERDQWYDVNGVWTGSTTILPNNKLVVLYTGSTNESVQVQNLAYPANPSDPLLVNWVKDPANPVLVPPSWINIKDFRDPTTAWLTPEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029725`
TK1151 ID	TkA07G341880
OH-1004 ID	LXL04_029725
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 75.676 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029725

Location Chr06:98639970-98642642 (-)

Description Similar to Acid beta-fructofuranosidase 2, vacuolar

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12240`	Possible role in the continued mobilization of sucrose to sink organs.	Mathematical modeling of the central carbohydrate metabolism in Arabidopsis reveals a substantial regulatory influence of vacuolar invertase on whole plant carbon metabolism.2010 · DOI: 10.1104/pp.110.154443

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029725 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0005985 sucrose metabolic process Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0071370 cellular response to gibberellin stimulus Biological Process

GO:0080022 primary root development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005775 vacuolar lumen Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G12240

vra:106768621

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.394

Rank 1 · LXL04_029725 · OH-1004

Golgi apparatus0.274

Rank 2 · LXL04_029725 · OH-1004

Endoplasmic reticulum0.206

Rank 3 · LXL04_029725 · OH-1004

Cytoplasm0.162

Rank 4 · LXL04_029725 · OH-1004

Cell membrane0.116

Rank 5 · LXL04_029725 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11837.14INV_N23-111 aa

PF00251.27Glyco_hydro_32N119-433 aa

PF08244.20Glyco_hydro_32C436-628 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029725	`PF11837.14`	INV_N	23	111	2.4e-06	28.7
LXL04_029725	`PF00251.27`	Glyco_hydro_32N	119	433	1.2e-93	314.8
LXL04_029725	`PF08244.20`	Glyco_hydro_32C	436	628	5.7e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39041`	Arabidopsis thaliana	Acid beta-fructofuranosidase 4, vacuolar	57.984%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card