TkA07G335820 | RubberDandelionOmics

Gene overview

TkA07G335820

Reference: TK1151 Chr: Chr07 Coordinates: 83877336-83879346 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1257 bp · TkA07G335820|TK1151|cDNA

CACGTTTTTGGAACTTCTTCTACAAAGACTGCCATTCTGTGTTTGGTACACAGACACTCGGAAGCACATTCGTTTCAAGATTCCATTTTGATTCATTTCTGGCGCTTTACTCATTTCAGATTTCAGATTTGCTCTTCGACACCCTTGGGAACGATGACGGCGTCCGCAGATGATATTTCGGAGAGCGGCAAAGCTACACTTGTGTCACTTGCTCCACTAGAAGCAGTATTATTTGATGTTGATGGAACTCTTTGTGATTC...

CDS

Download CDS FASTA

975 bp · TkA07G335820|TK1151|CDS

CACGTTTTTGGAACTTCTTCTACAAAGACTGCCATTCTGTGTTTGGTACACAGACACTCGGAAGCACATTCGTTTCAAGATTCCATTTTGATTCATTTCTGGCGCTTTACTCATTTCAGATTTCAGATTTGCTCTTCGACACCCTTGGGAACGATGACGGCGTCCGCAGATGATATTTCGGAGAGCGGCAAAGCTACACTTGTGTCACTTGCTCCACTAGAAGCAGTATTATTTGATGTTGATGGAACTCTTTGTGATTC...

Protein

Download Protein FASTA

324 aa · TkA07G335820|TK1151|PROTEIN

HVFGTSSTKTAILCLVHRHSEAHSFQDSILIHFWRFTHFRFQICSSTPLGTMTASADDISESGKATLVSLAPLEAVLFDVDGTLCDSDPIHHIAFQEMLQEIGFNNGVPIDEDFFIKNIAGKHNDDIAAVLFPDDIPRGLNFCQDKEAYFRKLVKEKVEPIKGLYKLTKWVEDHGLKRAAVTNAPRPNAELMISTLGLTDFFHCLIIGDECEHPKPSPDPYLKALQALNVSKAHTFICEDSVSGIKAGVAAEMPVVGLST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G335820`
TK1151 ID	TkA07G335820
OH-1004 ID	LXL04_029681
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 85.494 / OH-1004 53.578 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G335820

Location Chr07:83877336-83879346 (-)

Description Similar to SGPP: Haloacid dehalogenase-like hydrolase domain-containing protein Sgpp

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38740`	May catalyze dephosphorylation of diverse sugar-phosphate substrates.	HAD hydrolase function unveiled by substrate screening: enzymatic characterization of Arabidopsis thaliana subclass I phosphosugar phosphatase AtSgpp.2013 · DOI: 10.1007/s00425-012-1809-5
`At1g56500`	Required to maintain light harvesting efficiency, especially during nonphotochemical quenching (NPQ) recovery, via the regulation of chlorophyll excited-state lifetime probably by preventing the formation of a slowly reversible form of antenna quenching.	A thioredoxin-like/β-propeller protein maintains the efficiency of light harvesting in Arabidopsis.2013 · DOI: 10.1073/pnas.1305443110

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029681 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050308 sugar-phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14870

ath:AT1G14880

ath:AT2G38740

ath:AT5G35525

zma:100284761

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.553

Rank 1 · TkA07G335820 · TK1151

Cytoplasm0.183

Rank 2 · TkA07G335820 · TK1151

Mitochondrion0.131

Rank 3 · TkA07G335820 · TK1151

Nucleus0.090

Rank 4 · TkA07G335820 · TK1151

Endoplasmic reticulum0.082

Rank 5 · TkA07G335820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00702Hydrolase74-251 aa

PF13419HAD_276-257 aa

PF12710HAD76-201 aa

PF13242Hydrolase_like187-211 aa

PF13242Hydrolase_like215-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G335820	`PF00702`	Hydrolase	74	251	1.1e-21	78.8
TkA07G335820	`PF13419`	HAD_2	76	257	5.5e-28	98.9
TkA07G335820	`PF12710`	HAD	76	201	0.00058	21.0
TkA07G335820	`PF13242`	Hydrolase_like	187	211	0.055	14.1
TkA07G335820	`PF13242`	Hydrolase_like	215	260	0.055	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVJ5`	Arabidopsis thaliana	sp\|Q9ZVJ5\|SGGP_ARATH Haloacid dehalogenase-like hydrolase domain-containing protein Sgpp	72.300%	Swiss-Prot	High
`Q8VZ10`	Arabidopsis thaliana	sp\|Q8VZ10\|SOQ1_ARATH Protein SUPPRESSOR OF QUENCHING 1, chloroplastic	25.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card