TkA07G332550 | RubberDandelionOmics

Gene overview

TkA07G332550

Reference: TK1151 Chr: Chr07 Coordinates: 83142593-83145138 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1473 bp · TkA07G332550|TK1151|cDNA

CTAAAATCTCGCTTCTCTCTCCTCATTTTCCCGCTACTCCATAATCATCTGAATCTGGGCTCTGTGTGCGTATCTTTCTCCCCTTCTAAATCTTCGGTAAAACCCTAGCGAAGGTGGAGGAAACTTCAACTGGAATGATAGATGTTATGGTTGGAGTGAAAAAGGATCGACATACATTTGAATCCACCAACGAGATTGGGCTCACATCGACTTCATCCATTTCTGATAGTAATTATGATGCTAACACACCAGGATCTCAC...

CDS

Download CDS FASTA

1227 bp · TkA07G332550|TK1151|CDS

ATGATAGATGTTATGGTTGGAGTGAAAAAGGATCGACATACATTTGAATCCACCAACGAGATTGGGCTCACATCGACTTCATCCATTTCTGATAGTAATTATGATGCTAACACACCAGGATCTCACAATAGCCATGGGAGCAGCAATCAAACCAAACGTTCATCACAGGCAGGCTGGACAGATGACGAGGATAATCTTTTAACTAATGTAGTGAAGAAGTACAACGGGAGGAATTGGAAGAAAATAGCCGAACAAATGCC...

Protein

Download Protein FASTA

408 aa · TkA07G332550|TK1151|PROTEIN

MIDVMVGVKKDRHTFESTNEIGLTSTSSISDSNYDANTPGSHNSHGSSNQTKRSSQAGWTDDEDNLLTNVVKKYNGRNWKKIAEQMPGRTDVQCLHRWQKVLNPEIVKGPWTKEEDDHIVKMVEVHGCMKWSVIAKDLPGRIGKQCRERWHNHLDPAIKKEAWSKEEESNLTCYHQVYGNKWAEIARFLPGRTDNAIKNHWNSSLKKKLDLNMPPVLNKNLFTEKSAPRIDSNACSTDLALGNNDLTVTDQECCGLKPPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G332550`
TK1151 ID	TkA07G332550
OH-1004 ID	LXL04_018487
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.500
Protein coverage (%)	TK1151 43.137 / OH-1004 29.920 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G332550

Location Chr07:83142593-83145138 (+)

Description Similar to MYB3R5: Transcription factor MYB3R-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02320`	Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity).	No verified direct reference in this release
`At5g11510`	Transcription factor that binds 5'-AACGG-3' motifs in gene promoters.	R1R2R3-Myb proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.02801 Laser microdissection of Arabidopsis cells at the powdery mildew infection site reveals site-specific processes and regulators.2010 · DOI: 10.1073/pnas.0912492107 Mutations in MYB3R1 and MYB3R4 cause pleiotropic developmental defects and preferential down-regulation of multiple G2/M-specific genes in Arabidopsis.2011 · DOI: 10.1104/pp.111.180836 Genetic interaction between G2/M phase-specific transcription factor MYB3R4 and MAPKKK ANP3 for execution of cytokinesis in Arabidopsis thaliana.2015 · DOI: 10.4161/15592324.2014.990817
`At4g32730`	Transcription factor that binds 5'-AACGG-3' motifs in gene promoters.	R1R2R3-Myb proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.02801 Mutations in MYB3R1 and MYB3R4 cause pleiotropic developmental defects and preferential down-regulation of multiple G2/M-specific genes in Arabidopsis.2011 · DOI: 10.1104/pp.111.180836
`At3g09370`	Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity).	Transcriptional repression by MYB3R proteins regulates plant organ growth.2015 · DOI: 10.15252/embj.201490899

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0841500`	Transcription factor involved in abiotic stress responses.	Overexpression of an R1R2R3 MYB gene, OsMYB3R-2, increases tolerance to freezing, drought, and salt stress in transgenic Arabidopsis.2007 · DOI: 10.1104/pp.106.094532 Enhanced tolerance to chilling stress in OsMYB3R-2 transgenic rice is mediated by alteration in cell cycle and ectopic expression of stress genes.2009 · DOI: 10.1104/pp.108.133454

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018487 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009409 response to cold Biological Process

GO:0009620 response to fungus Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0032465 regulation of cytokinesis Biological Process

GO:0032875 regulation of DNA endoreduplication Biological Process

KEGG gene cross-reference

ath:AT3G09370

ath:AT4G32730

ath:AT5G02320

ath:AT5G11510

dosa:Os01g0841500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.934

Rank 1 · TkA07G332550 · TK1151

Cytoplasm0.124

Rank 2 · TkA07G332550 · TK1151

Cell membrane0.029

Rank 3 · TkA07G332550 · TK1151

Mitochondrion0.013

Rank 4 · TkA07G332550 · TK1151

Plastid0.012

Rank 5 · TkA07G332550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_752-98 aa

PF09111SLIDE53-85 aa

PF16282SANT_DAMP1_like56-80 aa

PF26019HTH_TIMELESS58-75 aa

PF00249Myb_DNA-binding59-102 aa

PF13921Myb_DNA-bind_659-118 aa

PF23082Myb_DNA-binding_259-95 aa

PF13837Myb_DNA-bind_463-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G332550	`PF15963`	Myb_DNA-bind_7	52	98	4.2e-06	27.2
TkA07G332550	`PF09111`	SLIDE	53	85	0.0013	19.5
TkA07G332550	`PF16282`	SANT_DAMP1_like	56	80	0.00019	22.3
TkA07G332550	`PF26019`	HTH_TIMELESS	58	75	0.65	11.0
TkA07G332550	`PF00249`	Myb_DNA-binding	59	102	2.8e-50	168.9
TkA07G332550	`PF13921`	Myb_DNA-bind_6	59	118	2.8e-40	137.0
TkA07G332550	`PF23082`	Myb_DNA-binding_2	59	95	0.0024	18.7
TkA07G332550	`PF13837`	Myb_DNA-bind_4	63	101	3.7	8.7
TkA07G332550	`PF10545`	MADF_DNA_bdg	73	100	0.77	10.9
TkA07G332550	`PF16282`	SANT_DAMP1_like	99	135	0.00019	22.3
TkA07G332550	`PF00249`	Myb_DNA-binding	108	154	2.8e-50	168.9
TkA07G332550	`PF15963`	Myb_DNA-bind_7	109	151	4.2e-06	27.2
TkA07G332550	`PF09111`	SLIDE	109	137	0.0013	19.5
TkA07G332550	`PF26019`	HTH_TIMELESS	109	118	0.65	11.0
TkA07G332550	`PF23082`	Myb_DNA-binding_2	110	141	0.0024	18.7
TkA07G332550	`PF13921`	Myb_DNA-bind_6	111	171	2.8e-40	137.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6R032`	Arabidopsis thaliana	sp\|Q6R032\|MB3R5_ARATH Transcription factor MYB3R-5	68.000%	Swiss-Prot	Low
`Q94FL9`	Arabidopsis thaliana	sp\|Q94FL9\|MB3R4_ARATH Transcription factor MYB3R-4	67.300%	Swiss-Prot	Low
`Q9S7G7`	Arabidopsis thaliana	sp\|Q9S7G7\|MB3R1_ARATH Transcription factor MYB3R-1	66.000%	Swiss-Prot	Low
`Q8H1P9`	Arabidopsis thaliana	sp\|Q8H1P9\|MB3R3_ARATH Transcription factor MYB3R-3	57.500%	Swiss-Prot	Low
`Q0JHU7`	Oryza sativa subsp. japonica	sp\|Q0JHU7\|MB3R2_ORYSJ Transcription factor MYB3R-2	68.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card