TkA07G329010 | RubberDandelionOmics

Gene overview

TkA07G329010

Reference: TK1151 Chr: Chr07 Coordinates: 82292164-82294420 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1566 bp · TkA07G329010|TK1151|cDNA

CTTTAGTCAAGAATTTGCAATAGCAAATGCAATCGACATCAACTTGGAGGTTTTAAGTAAGAAAAAACTGTGATTTTCTTTAGGAATTTAATAACTTGATTGTTCAATTTGTACCATGTTTTTAATTTTTGTTCGAGTTCAAGGTTCTTTAAACATCTAATTAGTATGACAATGCAATTTACCAGGTTGTTTAATGTTCAATGGAGGCCAAAAGCAAAGTTTCAAGTGCCTGAGAAGCTGGATTGATTACTAATAAATCT...

CDS

Download CDS FASTA

807 bp · TkA07G329010|TK1151|CDS

ATGCCACATGAAACACTTGCAAAACATCTTTTTCATTGGGAAACACAACCTATGAAATGGGCAATGAGGTTACGGGTGGCATTATATCTTGCAGAAGCCTTGGAGTATTGTACAAGCAAAGGGCGTGCTCTTTACCATGATCTTAACGCCTACAGAATAGTCTTTGATGATGATGCAAATCCAAGACTTTCTTGCTTTGGATTGATGAAGAATAGTAGGGATGGAAAAAGTTATAGCACAAACTTGGCATTTACACCTCC...

Protein

Download Protein FASTA

268 aa · TkA07G329010|TK1151|PROTEIN

MPHETLAKHLFHWETQPMKWAMRLRVALYLAEALEYCTSKGRALYHDLNAYRIVFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQMLTDSCLEGQFSNDDGTELVRLASRCLQYEPRERPNPRSLVSALVPLQKETEEPSHVLMGIPQGGLAMPLTPLGEACLRMDLTFIHGVLEKLGYKDDEGAATELSFGMWTNQIHDTLNSKKKGDSAFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G329010`
TK1151 ID	TkA07G329010
OH-1004 ID	LXL04_029617
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.881 / OH-1004 54.639 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G329010

Location Chr07:82292164-82294420 (-)

Description Similar to BSK7: Serine/threonine-protein kinase BSK7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63500`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	No verified direct reference in this release
`At5g41260`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175 A kinase-phosphatase signaling module with BSK8 and BSL2 involved in regulation of sucrose-phosphate synthase.2014 · DOI: 10.1021/pr5003164
`At4g00710`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175
`At5g59010`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	A mutation in Arabidopsis BSK5 encoding a brassinosteroid-signaling kinase protein affects responses to salinity and abscisic acid.2012 · DOI: 10.1016/j.bbrc.2012.08.118

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0684200`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of BRI1.	OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029617 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G63500

ath:AT4G00710

ath:AT5G41260

ath:AT5G59010

dosa:Os04g0684200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.598

Rank 1 · TkA07G329010 · TK1151

Nucleus0.266

Rank 2 · TkA07G329010 · TK1151

Cytoplasm0.265

Rank 3 · TkA07G329010 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA07G329010 · TK1151

Golgi apparatus0.033

Rank 5 · TkA07G329010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr6-176 aa

PF24476DUF758024-164 aa

PF00069Pkinase25-173 aa

PF25575TPR_BSK1_C207-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G329010	`PF07714`	PK_Tyr_Ser-Thr	6	176	1.3e-12	48.4
TkA07G329010	`PF24476`	DUF7580	24	164	0.18	12.1
TkA07G329010	`PF00069`	Pkinase	25	173	7.3e-13	49.2
TkA07G329010	`PF25575`	TPR_BSK1_C	207	265	1.2e-24	87.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I3M3`	Arabidopsis thaliana	sp\|F4I3M3\|BSK7_ARATH Serine/threonine-protein kinase BSK7	84.800%	Swiss-Prot	High
`Q9FHD7`	Arabidopsis thaliana	sp\|Q9FHD7\|BSK8_ARATH Serine/threonine-protein kinase BSK8	83.300%	Swiss-Prot	High
`Q8W4L3`	Arabidopsis thaliana	sp\|Q8W4L3\|BSK3_ARATH Serine/threonine-protein kinase BSK3	80.800%	Swiss-Prot	High
`Q9FIL1`	Arabidopsis thaliana	sp\|Q9FIL1\|BSK5_ARATH Serine/threonine-protein kinase BSK5	79.100%	Swiss-Prot	High
`B9FDE0`	Oryza sativa subsp. japonica	sp\|B9FDE0\|BSK3_ORYSJ Probable serine/threonine-protein kinase BSK3	80.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card